Details |
PBRRPTGINVTRY-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
PBRRPTGINVTRY-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BUKRS MemoryID: BUK AppClass: FB SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
PBRRPTGINVTRY-BUSINESSPLACE table field - Business Place
▼
Description: Business Place Field Name: BUSINESSPLACE Data Element: J_1BBRANC_ Data Type: CHAR length (Dec): 4(0) Check table: PBUSINESSPLACE Conversion Routine: Domain Name: J_1BBRANCH MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPLACE
|
PBRRPTGINVTRY-MATERIAL table field - Material in Respect of Which Stock is Managed
▼
Description: Material in Respect of Which Stock is Managed Field Name: MATERIAL Data Element: MATBF Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATERIAL
|
PBRRPTGINVTRY-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
PBRRPTGINVTRY-STORAGELOCATION table field - Storage location
▼
Description: Storage location Field Name: STORAGELOCATION Data Element: LGORT_D Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: LGORT MemoryID: LAG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field STORAGELOCATION
|
PBRRPTGINVTRY-BATCH table field - Batch Number (Stock Identifier)
▼
Description: Batch Number (Stock Identifier) Field Name: BATCH Data Element: NSDM_CHARG Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CHARG MemoryID: CHA AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCH
|
PBRRPTGINVTRY-SUPPLIER table field - Supplier for Special Stock
▼
Description: Supplier for Special Stock Field Name: SUPPLIER Data Element: NSDM_LIFNR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: KRED_C SHLP Field: LIFNR ConvExit: ALPHA See all SAP tables containing field SUPPLIER
|
PBRRPTGINVTRY-SDDOCUMENT table field - Sales order number of valuated sales order stock
▼
Description: Sales order number of valuated sales order stock Field Name: SDDOCUMENT Data Element: MAT_KDAUF Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: VBELN MemoryID: AUN AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SDDOCUMENT
|
PBRRPTGINVTRY-SDDOCUMENTITEM table field - Sales Order Item of Valuated Sales Order Stock
▼
Description: Sales Order Item of Valuated Sales Order Stock Field Name: SDDOCUMENTITEM Data Element: MAT_KDPOS Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: NUM06 MemoryID: KPO AppClass: MD SHLP: SHLP Field: ConvExit: See all SAP tables containing field SDDOCUMENTITEM
|
PBRRPTGINVTRY-WBSELEMENTINTERNALID table field - Valuated Sales Order Stock WBS Element
▼
Description: Valuated Sales Order Stock WBS Element Field Name: WBSELEMENTINTERNALID Data Element: MAT_PSPNR Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: ABPSP Domain Name: PS_POSNR MemoryID: AppClass: CN SHLP: SHLP Field: ConvExit: ABPSP See all SAP tables containing field WBSELEMENTINTERNALID
|
PBRRPTGINVTRY-CUSTOMER table field - Customer for Special Stock
▼
Description: Customer for Special Stock Field Name: CUSTOMER Data Element: NSDM_KUNNR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: KUN AppClass: V SHLP: C_KUNNR SHLP Field: KUNNR ConvExit: ALPHA See all SAP tables containing field CUSTOMER
|
PBRRPTGINVTRY-SPECIALSTOCKIDFGSTOCKOWNER table field - Add. Supplier for Special Stock
▼
Description: Add. Supplier for Special Stock Field Name: SPECIALSTOCKIDFGSTOCKOWNER Data Element: NSDM_DISUB_OWNER_SID Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field SPECIALSTOCKIDFGSTOCKOWNER
|
PBRRPTGINVTRY-INVENTORYSTOCKTYPE table field - Stock Type of Goods Movement (Stock Identifier)
▼
Description: Stock Type of Goods Movement (Stock Identifier) Field Name: INVENTORYSTOCKTYPE Data Element: NSDM_LBBSA Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: NSDM_LBBSA MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYSTOCKTYPE
|
PBRRPTGINVTRY-INVENTORYSPECIALSTOCKTYPE table field - Special Stock Type
▼
Description: Special Stock Type Field Name: INVENTORYSPECIALSTOCKTYPE Data Element: NSDM_SPCL_STOCK_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SOBKZ MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYSPECIALSTOCKTYPE
|
PBRRPTGINVTRY-MATERIALBASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: MATERIALBASEUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field MATERIALBASEUNIT
|
PBRRPTGINVTRY-COSTESTIMATE table field - Cost Estimate Number - Product Costing
▼
Description: Cost Estimate Number - Product Costing Field Name: COSTESTIMATE Data Element: CK_KALNR1 Data Type: NUMC length (Dec): 12(0) Check table: Conversion Routine: Domain Name: CK_KALNR MemoryID: KNE AppClass: CK SHLP: SHLP Field: ConvExit: See all SAP tables containing field COSTESTIMATE
|
PBRRPTGINVTRY-INVENTORYPRICE table field -
▼
Description: Field Name: INVENTORYPRICE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INVENTORYPRICE
|
PBRRPTGINVTRY-MATERIALPRICEUNITQTY table field -
▼
Description: Field Name: MATERIALPRICEUNITQTY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALPRICEUNITQTY
|
PBRRPTGINVTRY-MATLWRHSSTKQTYINMATLBASEUNIT table field - Stock Quantity in Base Unit of Measure
▼
Description: Stock Quantity in Base Unit of Measure Field Name: MATLWRHSSTKQTYINMATLBASEUNIT Data Element: NSDM_MATERIAL_STOCK_IN_BUOM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLWRHSSTKQTYINMATLBASEUNIT
|
PBRRPTGINVTRY-STOCKVALUEINCCCRCY table field - Stock Value in Company Code Currency
▼
Description: Stock Value in Company Code Currency Field Name: STOCKVALUEINCCCRCY Data Element: NSDM_STOCK_VALUE_IN_CCCRCY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKVALUEINCCCRCY
|
PBRRPTGINVTRY-CURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: CURRENCY Data Element: WAERS Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: FWS AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
|
PBRRPTGINVTRY-CNSMPNLATESTPOSTGDATE table field - Date of Last Consumption Posting
▼
Description: Date of Last Consumption Posting Field Name: CNSMPNLATESTPOSTGDATE Data Element: NSDM_DATE_OF_LAST_CONSUMPTION Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CNSMPNLATESTPOSTGDATE
|
PBRRPTGINVTRY-MATLDOCLATESTPOSTGDATE table field - Date of Last Posting
▼
Description: Date of Last Posting Field Name: MATLDOCLATESTPOSTGDATE Data Element: NSDM_DATE_OF_LAST_POSTING Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLDOCLATESTPOSTGDATE
|
PBRRPTGINVTRY-NUMBEROFDAYSSINCELASTCNSMPN table field - Number of Days Since Last Consumption Posting
▼
Description: Number of Days Since Last Consumption Posting Field Name: NUMBEROFDAYSSINCELASTCNSMPN Data Element: NSDM_NUMOFDAYSINCECONSUMPTION Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDAYSSINCELASTCNSMPN
|
PBRRPTGINVTRY-NUMBEROFDAYSSINCELASTMOVEMENT table field - Number of Days Since Last Posting
▼
Description: Number of Days Since Last Posting Field Name: NUMBEROFDAYSSINCELASTMOVEMENT Data Element: NSDM_NUMOFDAYSINCEPOSTING Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFDAYSSINCELASTMOVEMENT
|
PBRRPTGINVTRY-MATERIALGROUP table field - Material Group
▼
Description: Material Group Field Name: MATERIALGROUP Data Element: MATKL Data Type: CHAR length (Dec): 9(0) Check table: T023 Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATERIALGROUP
|
PBRRPTGINVTRY-MATERIALGROUPNAME table field - Material Group Description
▼
Description: Material Group Description Field Name: MATERIALGROUPNAME Data Element: NSDM_WGBEZ Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: TEXT20 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALGROUPNAME
|
PBRRPTGINVTRY-MATERIALTYPE table field - Material type
▼
Description: Material type Field Name: MATERIALTYPE Data Element: MTART Data Type: CHAR length (Dec): 4(0) Check table: T134 Conversion Routine: Domain Name: MTART MemoryID: MTA AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALTYPE
|
PBRRPTGINVTRY-MATERIALTYPENAME table field - Description of Material Type
▼
Description: Description of Material Type Field Name: MATERIALTYPENAME Data Element: NSDM_MTBEZ Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: TEXT25 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALTYPENAME
|
PBRRPTGINVTRY-MATERIALNAME table field - Material Description
▼
Description: Material Description Field Name: MATERIALNAME Data Element: MAKTX Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: TEXT40 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATERIALNAME
|
PBRRPTGINVTRY-PLANTNAME table field - Plant Name
▼
Description: Plant Name Field Name: PLANTNAME Data Element: WERKS_NAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: TEXT30 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANTNAME
|
PBRRPTGINVTRY-CHARTOFACCOUNTS table field - Chart of Accounts
▼
Description: Chart of Accounts Field Name: CHARTOFACCOUNTS Data Element: KTOPL Data Type: CHAR length (Dec): 4(0) Check table: T004 Conversion Routine: Domain Name: KTOPL MemoryID: KPL AppClass: FB SHLP: C_KTOPL SHLP Field: KTOPL ConvExit: See all SAP tables containing field CHARTOFACCOUNTS
|
PBRRPTGINVTRY-VALUATIONAREA table field - Valuation area
▼
Description: Valuation area Field Name: VALUATIONAREA Data Element: BWKEY Data Type: CHAR length (Dec): 4(0) Check table: T001K Conversion Routine: Domain Name: BWKEY MemoryID: BWK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUATIONAREA
|