Details |
FAP_RSIV_TMPLR-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
FAP_RSIV_TMPLR-RECRRGSUPLRINVCTMPLUUID table field - GUID in recurring supplier invoice template
▼
Description: GUID in recurring supplier invoice template Field Name: RECRRGSUPLRINVCTMPLUUID Data Element: FAP_RSIV_GUID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: FAP_RSIV_GUID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECRRGSUPLRINVCTMPLUUID
|
FAP_RSIV_TMPLR-RECRRGSUPPLIERINVOICETEMPLATE table field - Accounting Document Number
▼
Description: Accounting Document Number Field Name: RECRRGSUPPLIERINVOICETEMPLATE Data Element: BELNR_D Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: BLN AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field RECRRGSUPPLIERINVOICETEMPLATE
|
FAP_RSIV_TMPLR-FISCALYEAR table field - Fiscal Year
▼
Description: Fiscal Year Field Name: FISCALYEAR Data Element: FIS_GJAHR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field FISCALYEAR
|
FAP_RSIV_TMPLR-ACCOUNTINGDOCUMENTTYPE table field - Document Type
▼
Description: Document Type Field Name: ACCOUNTINGDOCUMENTTYPE Data Element: FARP_RECURR_BLART Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: BLART MemoryID: BAR AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTTYPE
|
FAP_RSIV_TMPLR-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BUKRS MemoryID: BUK AppClass: FB SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
FAP_RSIV_TMPLR-DOCUMENTREFERENCEID table field - Reference Document Number
▼
Description: Reference Document Number Field Name: DOCUMENTREFERENCEID Data Element: XBLNR1 Data Type: CHAR length (Dec): 16(0) Check table: Conversion Routine: Domain Name: XBLNR1 MemoryID: AppClass: MB SHLP: SHLP Field: ConvExit: See all SAP tables containing field DOCUMENTREFERENCEID
|
FAP_RSIV_TMPLR-ACCOUNTINGDOCUMENTHEADERTEXT table field - Document Header Text
▼
Description: Document Header Text Field Name: ACCOUNTINGDOCUMENTHEADERTEXT Data Element: BKTXT Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: TEXT25 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACCOUNTINGDOCUMENTHEADERTEXT
|
FAP_RSIV_TMPLR-TOTALAMOUNTINTRANSACTIONCRCY table field - Gross Invoice Amount in Document Currency
▼
Description: Gross Invoice Amount in Document Currency Field Name: TOTALAMOUNTINTRANSACTIONCRCY Data Element: FAP_RECURR_DMBTR_CS Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTALAMOUNTINTRANSACTIONCRCY
|
FAP_RSIV_TMPLR-INVOICINGPARTY table field - Different Invoicing Party
▼
Description: Different Invoicing Party Field Name: INVOICINGPARTY Data Element: LIFRE Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LRE AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INVOICINGPARTY
|
FAP_RSIV_TMPLR-EXCHANGERATE table field - Exchange Rate
▼
Description: Exchange Rate Field Name: EXCHANGERATE Data Element: UKURS_CURR Data Type: DEC length (Dec): 9(5) Check table: Conversion Routine: EXCRT Domain Name: UKURS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: EXCRT See all SAP tables containing field EXCHANGERATE
|
FAP_RSIV_TMPLR-GROSSAMTINTC table field - Gross amount in Transaction Currency
▼
Description: Gross amount in Transaction Currency Field Name: GROSSAMTINTC Data Element: JV_GRSAMT_TC Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field GROSSAMTINTC
|
FAP_RSIV_TMPLR-TOTALAMOUNTINLOCALCURRENCY table field - Signed Amount in Local Currency (Long)
▼
Description: Signed Amount in Local Currency (Long) Field Name: TOTALAMOUNTINLOCALCURRENCY Data Element: DMBTR_SHL Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: Domain Name: WERTV12 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTALAMOUNTINLOCALCURRENCY
|
FAP_RSIV_TMPLR-LOCALCURRENCY table field - Local Currency
▼
Description: Local Currency Field Name: LOCALCURRENCY Data Element: FC_CURR Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: FC_WAERS SHLP Field: WAERS ConvExit: See all SAP tables containing field LOCALCURRENCY
|
FAP_RSIV_TMPLR-TRANSACTIONCURRENCY table field - Transaction Currency
▼
Description: Transaction Currency Field Name: TRANSACTIONCURRENCY Data Element: FIS_RWCUR Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSACTIONCURRENCY
|
FAP_RSIV_TMPLR-DOCUMENTCURRENCY table field - Document Currency
▼
Description: Document Currency Field Name: DOCUMENTCURRENCY Data Element: /SCMTMS/DOC_CURRENCY Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: H_TCURC SHLP Field: WAERS ConvExit: See all SAP tables containing field DOCUMENTCURRENCY
|
FAP_RSIV_TMPLR-TRANSACTIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: TRANSACTIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TRANSACTIONDATE
|
FAP_RSIV_TMPLR-ASSIGNMENTREFERENCE table field - Assignment Reference
▼
Description: Assignment Reference Field Name: ASSIGNMENTREFERENCE Data Element: FAP_RECURR_FIS_ZUONR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ASSIGNMENTREFERENCE
|
FAP_RSIV_TMPLR-SUPPLIERBANKTYPE table field - Partner bank type
▼
Description: Partner bank type Field Name: SUPPLIERBANKTYPE Data Element: BVTYP Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BVTYP MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERBANKTYPE
|
FAP_RSIV_TMPLR-IBAN table field - IBAN (International Bank Account Number)
▼
Description: IBAN (International Bank Account Number) Field Name: IBAN Data Element: IBAN Data Type: CHAR length (Dec): 34(0) Check table: Conversion Routine: Domain Name: IBAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field IBAN
|
FAP_RSIV_TMPLR-SWIFTCODE table field - SWIFT/BIC for International Payments
▼
Description: SWIFT/BIC for International Payments Field Name: SWIFTCODE Data Element: SWIFT Data Type: CHAR length (Dec): 11(0) Check table: Conversion Routine: Domain Name: SWIFT MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field SWIFTCODE
|
FAP_RSIV_TMPLR-BUSINESSAREA table field - Business Area
▼
Description: Business Area Field Name: BUSINESSAREA Data Element: GSBER Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: GSBER MemoryID: GSB AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSAREA
|
FAP_RSIV_TMPLR-COMPANYCODECOUNTRY table field - Reporting Country/Region for Delivery of Goods Within the EU
▼
Description: Reporting Country/Region for Delivery of Goods Within the EU Field Name: COMPANYCODECOUNTRY Data Element: EGMLD_BSEZ Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODECOUNTRY
|
FAP_RSIV_TMPLR-SUPPLIERVATREGISTRATION table field - VAT Registration Number
▼
Description: VAT Registration Number Field Name: SUPPLIERVATREGISTRATION Data Element: STCEG Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: Domain Name: STCEG MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLIERVATREGISTRATION
|
FAP_RSIV_TMPLR-ISEUTRIANGULARDEAL table field - Indicator: Triangular Deal Within the EU
▼
Description: Indicator: Triangular Deal Within the EU Field Name: ISEUTRIANGULARDEAL Data Element: XEGDR Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISEUTRIANGULARDEAL
|
FAP_RSIV_TMPLR-CREATEDBYUSER table field - Name of the Processor Who Entered the Object
▼
Description: Name of the Processor Who Entered the Object Field Name: CREATEDBYUSER Data Element: ERFNAM Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
FAP_RSIV_TMPLR-USERNAME table field - Full Name of Person
▼
Description: Full Name of Person Field Name: USERNAME Data Element: FAC_RJET_RECURRENCE_ENTERED Data Type: CHAR length (Dec): 80(0) Check table: Conversion Routine: Domain Name: TEXT80 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field USERNAME
|
FAP_RSIV_TMPLR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FARP_RECURR_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
FAP_RSIV_TMPLR-RECRRGSUPLRINVCISSRVCINVOICE table field - Service Indicator (Foreign Payment)
▼
Description: Service Indicator (Foreign Payment) Field Name: RECRRGSUPLRINVCISSRVCINVOICE Data Element: DIEKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: DIEKZ MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECRRGSUPLRINVCISSRVCINVOICE
|
FAP_RSIV_TMPLR-STATECENTRALBANKPAYMENTREASON table field - State Central Bank Indicator
▼
Description: State Central Bank Indicator Field Name: STATECENTRALBANKPAYMENTREASON Data Element: LZBKZ Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LZBKZ MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATECENTRALBANKPAYMENTREASON
|
FAP_RSIV_TMPLR-SUPPLYINGCOUNTRY table field - Supplying Country/Region
▼
Description: Supplying Country/Region Field Name: SUPPLYINGCOUNTRY Data Element: LANDL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPPLYINGCOUNTRY
|
FAP_RSIV_TMPLR-ACTIVECOUNTRY table field - Supplying Country/Region
▼
Description: Supplying Country/Region Field Name: ACTIVECOUNTRY Data Element: LANDL Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ACTIVECOUNTRY
|
FAP_RSIV_TMPLR-PAYMENTTERMS table field - Terms of payment key
▼
Description: Terms of payment key Field Name: PAYMENTTERMS Data Element: DZTERM Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTTERMS
|
FAP_RSIV_TMPLR-PAYMENTMETHOD table field - Payment Method
▼
Description: Payment Method Field Name: PAYMENTMETHOD Data Element: DZLSCH Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTMETHOD
|
FAP_RSIV_TMPLR-PAYMENTREFERENCE table field - Payment Reference
▼
Description: Payment Reference Field Name: PAYMENTREFERENCE Data Element: KIDNO Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CHAR30 MemoryID: AppClass: KKEK SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTREFERENCE
|
FAP_RSIV_TMPLR-CASHDISCOUNT1DAYS table field - Cash discount days 1
▼
Description: Cash discount days 1 Field Name: CASHDISCOUNT1DAYS Data Element: DZBD1T Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHDISCOUNT1DAYS
|
FAP_RSIV_TMPLR-CASHDISCOUNT1PERCENT table field - Cash discount percentage 1
▼
Description: Cash discount percentage 1 Field Name: CASHDISCOUNT1PERCENT Data Element: DZBD1P Data Type: DEC length (Dec): 5(3) Check table: Conversion Routine: Domain Name: PRZ23 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHDISCOUNT1PERCENT
|
FAP_RSIV_TMPLR-CASHDISCOUNT2DAYS table field - Cash discount days 2
▼
Description: Cash discount days 2 Field Name: CASHDISCOUNT2DAYS Data Element: DZBD2T Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHDISCOUNT2DAYS
|
FAP_RSIV_TMPLR-CASHDISCOUNT2PERCENT table field - Cash Discount Percentage 2
▼
Description: Cash Discount Percentage 2 Field Name: CASHDISCOUNT2PERCENT Data Element: DZBD2P Data Type: DEC length (Dec): 5(3) Check table: Conversion Routine: Domain Name: PRZ23 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CASHDISCOUNT2PERCENT
|
FAP_RSIV_TMPLR-NETPAYMENTDAYS table field - Net Payment Terms Period
▼
Description: Net Payment Terms Period Field Name: NETPAYMENTDAYS Data Element: DZBD3T Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field NETPAYMENTDAYS
|
FAP_RSIV_TMPLR-HOUSEBANK table field - Short Key for a House Bank
▼
Description: Short Key for a House Bank Field Name: HOUSEBANK Data Element: HBKID Data Type: CHAR length (Dec): 5(0) Check table: Conversion Routine: Domain Name: HBKID MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field HOUSEBANK
|
FAP_RSIV_TMPLR-HOUSEBANKACCOUNT table field - ID for Account Details
▼
Description: ID for Account Details Field Name: HOUSEBANKACCOUNT Data Element: HKTID Data Type: CHAR length (Dec): 5(0) Check table: Conversion Routine: Domain Name: HKTID MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field HOUSEBANKACCOUNT
|
FAP_RSIV_TMPLR-MANUALCASHDISCOUNT table field - Amount in local currency
▼
Description: Amount in local currency Field Name: MANUALCASHDISCOUNT Data Element: DMBTR Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: AU132 Domain Name: AFLE13D2O16N_TO_23D2O30N MemoryID: AppClass: SHLP: SHLP Field: ConvExit: AU132 See all SAP tables containing field MANUALCASHDISCOUNT
|
FAP_RSIV_TMPLR-INVOICEREFERENCE table field - Invoice reference: Document number for invoice reference
▼
Description: Invoice reference: Document number for invoice reference Field Name: INVOICEREFERENCE Data Element: AWREF_REB Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: AWREF MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INVOICEREFERENCE
|
FAP_RSIV_TMPLR-PAYMENTMETHODSUPPLEMENT table field - Payment method supplement
▼
Description: Payment method supplement Field Name: PAYMENTMETHODSUPPLEMENT Data Element: UZAWE Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: UZAWE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYMENTMETHODSUPPLEMENT
|
FAP_RSIV_TMPLR-SUPLRINVCPAYMENTBLOCKINGREASON table field - Payment Block Key
▼
Description: Payment Block Key Field Name: SUPLRINVCPAYMENTBLOCKINGREASON Data Element: DZLSPR Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: SPE AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SUPLRINVCPAYMENTBLOCKINGREASON
|
FAP_RSIV_TMPLR-PAYTSLIPWTHREFCHECKDIGIT table field - POR Check Digit
▼
Description: POR Check Digit Field Name: PAYTSLIPWTHREFCHECKDIGIT Data Element: FARP_ESRPZ Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CHAR2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYTSLIPWTHREFCHECKDIGIT
|
FAP_RSIV_TMPLR-PAYTSLIPWTHREFREFERENCE table field - POR Reference Number
▼
Description: POR Reference Number Field Name: PAYTSLIPWTHREFREFERENCE Data Element: FARP_ESRRE Data Type: CHAR length (Dec): 27(0) Check table: Conversion Routine: ALPHA Domain Name: ESRRE MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PAYTSLIPWTHREFREFERENCE
|
FAP_RSIV_TMPLR-PAYTSLIPWTHREFSUBSCRIBER table field - POR Subscriber Number
▼
Description: POR Subscriber Number Field Name: PAYTSLIPWTHREFSUBSCRIBER Data Element: FARP_ESRNR Data Type: CHAR length (Dec): 11(0) Check table: Conversion Routine: Domain Name: ESRNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field PAYTSLIPWTHREFSUBSCRIBER
|
FAP_RSIV_TMPLR-TAXCODE table field - Tax code
▼
Description: Tax code Field Name: TAXCODE Data Element: MWSKZ_MRM1 Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MRM_MWSKZ MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXCODE
|
FAP_RSIV_TMPLR-FIXEDCASHDISCOUNT table field - Fixed Payment Terms
▼
Description: Fixed Payment Terms Field Name: FIXEDCASHDISCOUNT Data Element: DZBFIX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIXEDCASHDISCOUNT
|
FAP_RSIV_TMPLR-TAXBASEAMOUNTINTRANSCRCY table field - Tax Amount in Document Currency with +/- Sign
▼
Description: Tax Amount in Document Currency with +/- Sign Field Name: TAXBASEAMOUNTINTRANSCRCY Data Element: FWSTEV Data Type: CURR length (Dec): 13(2) Check table: Conversion Routine: Domain Name: WERTV7 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXBASEAMOUNTINTRANSCRCY
|
FAP_RSIV_TMPLR-TAXDETERMINATIONDATE table field - Date for Determining Tax Rates
▼
Description: Date for Determining Tax Rates Field Name: TAXDETERMINATIONDATE Data Element: TXDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXDETERMINATIONDATE
|
FAP_RSIV_TMPLR-TAXJURISDICTIONBYPROVIDER table field - Tax Jurisdiction
▼
Description: Tax Jurisdiction Field Name: TAXJURISDICTIONBYPROVIDER Data Element: TXJCD Data Type: CHAR length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TXJCD MemoryID: TXJ AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field TAXJURISDICTIONBYPROVIDER
|
FAP_RSIV_TMPLR-TAXCOUNTRY table field - Tax Reporting Country/Region
▼
Description: Tax Reporting Country/Region Field Name: TAXCOUNTRY Data Element: FOT_TAX_COUNTRY Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: FOT_TXA_F4_FRGN_REGISTRATIONS SHLP Field: TAX_COUNTRY ConvExit: See all SAP tables containing field TAXCOUNTRY
|
FAP_RSIV_TMPLR-WITHHOLDINGTAXISENABLED table field - General Flag
▼
Description: General Flag Field Name: WITHHOLDINGTAXISENABLED Data Element: FLAG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FLAG MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WITHHOLDINGTAXISENABLED
|
FAP_RSIV_TMPLR-GLACCOUNT table field - General Ledger Account
▼
Description: General Ledger Account Field Name: GLACCOUNT Data Element: HKONT Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: SAKNR MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field GLACCOUNT
|
FAP_RSIV_TMPLR-STARTDATE table field - Recurrence Start Date
▼
Description: Recurrence Start Date Field Name: STARTDATE Data Element: FAC_RJET_START_OCCUR_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTDATE
|
FAP_RSIV_TMPLR-CALENDARDAY table field - Occurrence Day in a Month
▼
Description: Occurrence Day in a Month Field Name: CALENDARDAY Data Element: FAC_RJET_DAY_OF_MONTH Data Type: NUMC length (Dec): 2(0) Check table: Conversion Routine: Domain Name: NUM2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CALENDARDAY
|
FAP_RSIV_TMPLR-WEEKDAY table field - Occurrence Day in a Week
▼
Description: Occurrence Day in a Week Field Name: WEEKDAY Data Element: FAC_RJET_DAY_OF_WEEK Data Type: NUMC length (Dec): 1(0) Check table: Conversion Routine: Domain Name: NUM1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WEEKDAY
|
FAP_RSIV_TMPLR-FIRSTOCCURRENCEDATE table field - First Occurrence Date
▼
Description: First Occurrence Date Field Name: FIRSTOCCURRENCEDATE Data Element: FAC_RJET_FIRST_OCCUR_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIRSTOCCURRENCEDATE
|
FAP_RSIV_TMPLR-NEXTOCCURRENCEDATE table field - Next Calculation Date of the Recurring Entry
▼
Description: Next Calculation Date of the Recurring Entry Field Name: NEXTOCCURRENCEDATE Data Element: DBATR Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field NEXTOCCURRENCEDATE
|
FAP_RSIV_TMPLR-ESTDCOSTCOSTGRUNRCRRCDATE table field - Costing Run Date for Recurrence
▼
Description: Costing Run Date for Recurrence Field Name: ESTDCOSTCOSTGRUNRCRRCDATE Data Element: CK_REC_DAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SYST SHLP: SHLP Field: ConvExit: See all SAP tables containing field ESTDCOSTCOSTGRUNRCRRCDATE
|
FAP_RSIV_TMPLR-NEXTOCCURRENCEAMOUNTINTC table field - Amount in local currency
▼
Description: Amount in local currency Field Name: NEXTOCCURRENCEAMOUNTINTC Data Element: DMBTR Data Type: CURR length (Dec): 23(2) Check table: Conversion Routine: AU132 Domain Name: AFLE13D2O16N_TO_23D2O30N MemoryID: AppClass: SHLP: SHLP Field: ConvExit: AU132 See all SAP tables containing field NEXTOCCURRENCEAMOUNTINTC
|
FAP_RSIV_TMPLR-RECURRENCETYPE table field - Recurrence Type
▼
Description: Recurrence Type Field Name: RECURRENCETYPE Data Element: FAC_RJET_RECURRENCE_PATTERN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FAC_RJET_RECURRENCE_PATTERN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCETYPE
|
FAP_RSIV_TMPLR-RECURRENCEPATTERN table field - Recurrence Type
▼
Description: Recurrence Type Field Name: RECURRENCEPATTERN Data Element: FAC_RJET_RECURRENCE_PATTERN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FAC_RJET_RECURRENCE_PATTERN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEPATTERN
|
FAP_RSIV_TMPLR-RECURRENCEFREQUENCY table field - Interval In Days
▼
Description: Interval In Days Field Name: RECURRENCEFREQUENCY Data Element: FAC_RJET_RECURR_DAY_FREQUENCY Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEFREQUENCY
|
FAP_RSIV_TMPLR-RESTARTFREQUENCYWEEK table field - Interval In Weeks
▼
Description: Interval In Weeks Field Name: RESTARTFREQUENCYWEEK Data Element: FAC_RJET_RECURR_WEK_FREQUENCY Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field RESTARTFREQUENCYWEEK
|
FAP_RSIV_TMPLR-REFREQUENCYSTART table field - Interval In Months
▼
Description: Interval In Months Field Name: REFREQUENCYSTART Data Element: FAC_RJET_RECURR_MON_FREQUENCY Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field REFREQUENCYSTART
|
FAP_RSIV_TMPLR-RECURRENCEINTERVAL table field - Interval Of Period
▼
Description: Interval Of Period Field Name: RECURRENCEINTERVAL Data Element: FAC_RJET_INTERVAL Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: TEXT10 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEINTERVAL
|
FAP_RSIV_TMPLR-RECURRENCEFREQUENCYINMONTH table field - Interval In Months
▼
Description: Interval In Months Field Name: RECURRENCEFREQUENCYINMONTH Data Element: FAC_RJET_RECURR_MON_FREQUENCY Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEFREQUENCYINMONTH
|
FAP_RSIV_TMPLR-RECURRENCEFREQUENCYINWEEK table field - Interval In Weeks
▼
Description: Interval In Weeks Field Name: RECURRENCEFREQUENCYINWEEK Data Element: FAC_RJET_RECURR_WEK_FREQUENCY Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEFREQUENCYINWEEK
|
FAP_RSIV_TMPLR-RECURRENCEFREQUENCYINDAY table field - Interval In Days
▼
Description: Interval In Days Field Name: RECURRENCEFREQUENCYINDAY Data Element: FAC_RJET_RECURR_DAY_FREQUENCY Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEFREQUENCYINDAY
|
FAP_RSIV_TMPLR-OCCURRENCETYPE table field - Occurrence Type
▼
Description: Occurrence Type Field Name: OCCURRENCETYPE Data Element: FAC_RJET_OCCUR_DAY_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FAC_RJET_OCCUR_DAY_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OCCURRENCETYPE
|
FAP_RSIV_TMPLR-OCCURRENCEDAYBYRECURRENCETYPE table field - Occurrence Day
▼
Description: Occurrence Day Field Name: OCCURRENCEDAYBYRECURRENCETYPE Data Element: FAC_RJET_OCCUR_DAY Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field OCCURRENCEDAYBYRECURRENCETYPE
|
FAP_RSIV_TMPLR-RECURRENCEENDTYPE table field - End Recurrence By
▼
Description: End Recurrence By Field Name: RECURRENCEENDTYPE Data Element: FAC_RJET_RECURR_END_BY_TYPE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FAC_RJET_RECURR_END_BY_TYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECURRENCEENDTYPE
|
FAP_RSIV_TMPLR-NUMBEROFOCCURRENCES table field - Number of Occurrences
▼
Description: Number of Occurrences Field Name: NUMBEROFOCCURRENCES Data Element: FAC_RJET_REC_NUMBER_OF_OCCUR Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFOCCURRENCES
|
FAP_RSIV_TMPLR-NUMBEROFPOSTEDINVOICES table field - Number of Occurrences
▼
Description: Number of Occurrences Field Name: NUMBEROFPOSTEDINVOICES Data Element: FAC_RJET_REC_NUMBER_OF_OCCUR Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFPOSTEDINVOICES
|
FAP_RSIV_TMPLR-NUMBEROFNOTPOSTEDINVOICES table field - Number of Occurrences
▼
Description: Number of Occurrences Field Name: NUMBEROFNOTPOSTEDINVOICES Data Element: FAC_RJET_REC_NUMBER_OF_OCCUR Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: INT2 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field NUMBEROFNOTPOSTEDINVOICES
|
FAP_RSIV_TMPLR-LASTOCCURRENCEDATE table field - Recurrence End Date
▼
Description: Recurrence End Date Field Name: LASTOCCURRENCEDATE Data Element: FAC_RJET_LAST_OCCUR_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTOCCURRENCEDATE
|
FAP_RSIV_TMPLR-FOREIGNCRCYAMTCNVRSNRULE table field - Conversion Rule for Foreign Currency Amounts
▼
Description: Conversion Rule for Foreign Currency Amounts Field Name: FOREIGNCRCYAMTCNVRSNRULE Data Element: FAC_RJET_TRANS_LC_AMTS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FAC_RJET_TRANS_LC_AMTS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FOREIGNCRCYAMTCNVRSNRULE
|
FAP_RSIV_TMPLR-RECRRGSUPLRINVCTEMPLATESTATUS table field - recurring supplier invoice template status
▼
Description: recurring supplier invoice template status Field Name: RECRRGSUPLRINVCTEMPLATESTATUS Data Element: FAP_TMPL_STATUS Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: FAP_TMPL_STATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field RECRRGSUPLRINVCTEMPLATESTATUS
|
FAP_RSIV_TMPLR-BUSINESSPLACE table field - Business Place
▼
Description: Business Place Field Name: BUSINESSPLACE Data Element: FARP_BUPLA Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: J_1BBRANCH MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUSINESSPLACE
|
FAP_RSIV_TMPLR-BUSINESSSECTIONCODE table field - Section Code
▼
Description: Section Code Field Name: BUSINESSSECTIONCODE Data Element: SECCO Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: SECCO MemoryID: AppClass: SHLP: SECCO_ABA SHLP Field: SECCODE ConvExit: See all SAP tables containing field BUSINESSSECTIONCODE
|
FAP_RSIV_TMPLR-IN_GSTPARTNER table field - GST Partner
▼
Description: GST Partner Field Name: IN_GSTPARTNER Data Element: J_1IG_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: J_1IG_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field IN_GSTPARTNER
|
FAP_RSIV_TMPLR-IN_GSTPLACEOFSUPPLY table field - Place of Supply
▼
Description: Place of Supply Field Name: IN_GSTPLACEOFSUPPLY Data Element: J_1IG_REGION Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: REGIO MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field IN_GSTPLACEOFSUPPLY
|
FAP_RSIV_TMPLR-IN_INVOICEREFERENCENUMBER table field - Invoice Reference Number
▼
Description: Invoice Reference Number Field Name: IN_INVOICEREFERENCENUMBER Data Element: J_1IG_IRN Data Type: CHAR length (Dec): 64(0) Check table: Conversion Routine: Domain Name: J_1IG_IRN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field IN_INVOICEREFERENCENUMBER
|
FAP_RSIV_TMPLR-SETTLMTCOCODETAXCOUNTRY table field - Tax Country/Region Company Code
▼
Description: Tax Country/Region Company Code Field Name: SETTLMTCOCODETAXCOUNTRY Data Element: WLF_LANDTX_BUKRS Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: LAND1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field SETTLMTCOCODETAXCOUNTRY
|