| Details |
PSOS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOS table
|
CPOFS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOFS table
|
CMPDMR-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPDMR table
|
CMPPRH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPPRH table
|
IMPDMR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPDMR table
|
IPRSSP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSP table
|
IVCSIM-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCSIM table
|
PCNLRD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNLRD table
|
PMMSOS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMSOS table
|
CCOELTP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOELTP table
|
CFCOBJP-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFCOBJP table
|
CMPPRHI-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPPRHI table
|
CQTWFIN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQTWFIN table
|
CSOWFIN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOWFIN table
|
IBAMREQ-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBAMREQ table
|
ICOELTP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOELTP table
|
IMCFNDN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDN table
|
IMCRPTC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCRPTC table
|
IPCNLRD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCNLRD table
|
IPSBASE-CREATIONDATE table field - Create Date
▼
Description: Create Date Field Name: CREATIONDATE Data Element: BNK_COM_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSBASE table
|
ISDSPCL-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSPCL table
|
PMCFNDN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMCFNDN table
|
PPSDAYS-CREATIONDATE table field - Create Date
▼
Description: Create Date Field Name: CREATIONDATE Data Element: BNK_COM_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPSDAYS table
|
CASSETTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CASSETTP table
|
CEF4OBJP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEF4OBJP table
|
CFUNDGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNDGRP table
|
CMDGBPCR-CREATIONDATE table field - Change Request Created On
▼
Description: Change Request Created On Field Name: CREATIONDATE Data Element: MDGOVCHGREQCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDGBPCR table
|
CPOHDRTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOHDRTP table
|
CPRFORGR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRFORGR table
|
IBSRHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBSRHIST table
|
IMPDMREQ-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPDMREQ table
|
IMPTMMEM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPTMMEM table
|
IPURREQN-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQN table
|
PBARRBSD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBARRBSD table
|
PBSRHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBSRHIST table
|
PPURGDOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGDOC table
|
CCABITREV-CREATIONDATE table field - Creation Date of Reversal Request for Billable Items
▼
Description: Creation Date of Reversal Request for Billable Items Field Name: CREATIONDATE Data Element: BITREVTRIG_CRDATE_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABITREV table
|
CCHILDGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHILDGRP table
|
CDEFECTCF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTCF table
|
CEFDOCWST-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEFDOCWST table
|
CFAGRPINC-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFAGRPINC table
|
CFAREAGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFAREAGRP table
|
CGLACOATP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLACOATP table
|
CGRANTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRANTGRP table
|
CMDGFINCR-CREATIONDATE table field - Change Request Created On
▼
Description: Change Request Created On Field Name: CREATIONDATE Data Element: MDGOVCHGREQCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDGFINCR table
|
CMFGGMETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGGMETP table
|
CPAYTADVC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYTADVC table
|
CPURORDTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDTP table
|
CPURREQWL-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQWL table
|
CSUPACTFS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPACTFS table
|
CSUPPLIST-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPPLIST table
|
CTRDCCCKF-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRDCCCKF table
|
CUTILDATA-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CUTILDATA table
|
FMLVCLRPA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMLVCLRPA table
|
FMLVPALBX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMLVPALBX table
|
IEMPLOYEE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEMPLOYEE table
|
IJRNLENTR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJRNLENTR table
|
IMFGGMETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGGMETP table
|
IPURORDTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURORDTP table
|
ITRDCCCKF-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRDCCCKF table
|
PBSRHIST2-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBSRHIST2 table
|
PCCICBASE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICBASE table
|
PIMPORTJE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIMPORTJE table
|
PPAYTADVC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPAYTADVC table
|
PRFQITEMS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRFQITEMS table
|
PSAVEDSIM-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSAVEDSIM table
|
PSIMOBJSR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMOBJSR table
|
APURREQACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQACC table
|
APURREQITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQITM table
|
CEQUIPMENT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEQUIPMENT table
|
CFPROGOBJP-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFPROGOBJP table
|
CFYCNGDWST-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFYCNGDWST table
|
CGLACOCDLI-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLACOCDLI table
|
CGLACOCDTD-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLACOCDTD table
|
CGLCOALIST-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLCOALIST table
|
CGRANTOBJP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRANTOBJP table
|
CGROSSMARG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGROSSMARG table
|
CMDGPRODCR-CREATIONDATE table field - Change Request Created On
▼
Description: Change Request Created On Field Name: CREATIONDATE Data Element: MDGOVCHGREQCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDGPRODCR table
|
CMDPRDHRYQ-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDPRDHRYQ table
|
CMPAORDITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPAORDITM table
|
CMPINVOICE-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPINVOICE table
|
CPARENTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPARENTGRP table
|
CPIRSTRUCT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPIRSTRUCT table
|
CPOACCRRVW-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOACCRRVW table
|
CPOCAGGPRC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCAGGPRC table
|
CPOCKPIALL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALL table
|
CPURRETDEL-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURRETDEL table
|
CPVOBJPGTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPVOBJPGTP table
|
CREVIEWREQ-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREVIEWREQ table
|
CSCHAGRMNT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: MMPUR_SES_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHAGRMNT table
|
CSENTITEMS-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSENTITEMS table
|
FMLVOPENPA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMLVOPENPA table
|
IFIACOCDLI-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACOCDLI table
|
IFMAVCITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMAVCITEM table
|
IJRNLENTRH-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJRNLENTRH table
|
IMAINTTLOP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTLOP table
|
IMDPRODFLT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDPRODFLT table
|
IMPDMRCUBE-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPDMRCUBE table
|
IMPINVCUBE-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPINVCUBE table
|
IMPINVOICE-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPINVOICE table
|
IPCLRDCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRDCUBE table
|
IPRODUCTWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODUCTWD table
|
IPRSSPITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPITEM table
|
IREVIEWREQ-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREVIEWREQ table
|
ISENTITEMS-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISENTITEMS table
|
ISRVENTDET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVENTDET table
|
PMPAORDITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPAORDITM table
|
PPOCMTDQTY-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOCMTDQTY table
|
PPRODUCTWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRODUCTWD table
|
PPURDOCCON-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURDOCCON table
|
PSIMOBJUNI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMOBJUNI table
|
PSRVENTDET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVENTDET table
|
PWRKUNIDOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWRKUNIDOC table
|
V_KPI_DATA-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_KPI_DATA table
|
AINSPRESULT-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPRESULT table
|
CCACORRHIST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCACORRHIST table
|
CCACUSTFOFS-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCACUSTFOFS table
|
CCFGGROUPWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCFGGROUPWD table
|
CCOMMITEMTP-CREATIONDATE table field - Commitment Item Created on Date
▼
Description: Commitment Item Created on Date Field Name: CREATIONDATE Data Element: FMCI_CREATED_AT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMMITEMTP table
|
CCONTRACTFS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCONTRACTFS table
|
CCONTRMNTRG-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCONTRMNTRG table
|
CCSHCONCNTP-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSHCONCNTP table
|
CDOCLINVDTL-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLINVDTL table
|
CEBWORDLOGH-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBWORDLOGH table
|
CFSVHIERCOA-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFSVHIERCOA table
|
CGLACCINCOA-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLACCINCOA table
|
CGLIOPRANLS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLIOPRANLS table
|
CINSPRESAGR-CREATIONDATE table field - Date on Which Data Record Was Created (Characteristic)
▼
Description: Date on Which Data Record Was Created (Characteristic) Field Name: CREATIONDATE Data Element: QMS_INSPRESAGGR_DATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPRESAGR table
|
CJRNLENICOR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJRNLENICOR table
|
CLCMCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLCMCHNGLOG table
|
CMAINTORDTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTORDTP table
|
CMATLDEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATLDEFECT table
|
CMDGBPPROCF-CREATIONDATE table field - Change Request Created On
▼
Description: Change Request Created On Field Name: CREATIONDATE Data Element: MDGOVCHGREQCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDGBPPROCF table
|
CMDGPRPROCF-CREATIONDATE table field - Change Request Created On
▼
Description: Change Request Created On Field Name: CREATIONDATE Data Element: MDGOVCHGREQCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDGPRPROCF table
|
CMMCPOIMONI-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMCPOIMONI table
|
CMMQTNENHWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMQTNENHWD table
|
CMMUNUSEDPC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMUNUSEDPC table
|
CMPPRSRCITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPPRSRCITM table
|
CMRWFDETAIL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRWFDETAIL table
|
CMXJRNLENTR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMXJRNLENTR table
|
CNTWBSCINFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTWBSCINFO table
|
COCIPRPUSGP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCIPRPUSGP table
|
CPRCHORDERS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRCHORDERS table
|
CPURGDOCSIM-CREATIONDATE table field - Date of job/step scheduling
▼
Description: Date of job/step scheduling Field Name: CREATIONDATE Data Element: BTCSDLDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCSIM table
|
CPURORDERFS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDERFS table
|
CPURREQNITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQNITM table
|
CQLTYTSKMNG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKMNG table
|
CREQTRACKPO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREQTRACKPO table
|
CREQTRACKPR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREQTRACKPR table
|
CSHPPLNDQRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSHPPLNDQRY table
|
CSIMOBJSRCH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIMOBJSRCH table
|
CSLCQNREVAL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLCQNREVAL table
|
CSOFSLSORDQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOFSLSORDQ table
|
CSTLFBPOBJP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTLFBPOBJP table
|
CSTLFFAOBJP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTLFFAOBJP table
|
CSUPPLIERFS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPPLIERFS table
|
CWBSBSCINFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWBSBSCINFO table
|
FMLVPAYMADV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMLVPAYMADV table
|
IACELINEITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACELINEITM table
|
IBANKCONDTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKCONDTP table
|
IBKACCTREVB-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBKACCTREVB table
|
ICOMMITEMTP-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOMMITEMTP table
|
ICSHCCNFLTR-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSHCCNFLTR table
|
ICSHCONCNTP-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSHCONCNTP table
|
IDEFECTCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTCUBE table
|
IEBWORDLOGH-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBWORDLOGH table
|
IFICMPTJRNL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICMPTJRNL table
|
IFMAVCITEMB-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMAVCITEMB table
|
IGRLINEITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGRLINEITEM table
|
IGRSSMARGIN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGRSSMARGIN table
|
IINBILLHIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINBILLHIST table
|
IINJRNLVCHR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINJRNLVCHR table
|
IJRNLENTRI1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJRNLENTRI1 table
|
IMMQTNENHWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNENHWD table
|
IMPRISKACTY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPRISKACTY table
|
IMPTEAMRESP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPTEAMRESP table
|
IMXJRNLENTR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMXJRNLENTR table
|
IPAYTADVCTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTADVCTP table
|
ISIENHANCED-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISIENHANCED table
|
ISQENHANCED-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQENHANCED table
|
PACELINEITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACELINEITM table
|
PEBWORDLOGH-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBWORDLOGH table
|
PEMPLOYEECL-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEMPLOYEECL table
|
PGMBDACTANA-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGMBDACTANA table
|
PJRNLENTRTP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PJRNLENTRTP table
|
PMATOVERDUE-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUE table
|
PMLCTRPFDBK-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 17(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMLCTRPFDBK table
|
PMMIRPRCVAR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMIRPRCVAR table
|
PPOITEMPAI4-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMPAI4 table
|
PPOITEMPAI6-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMPAI6 table
|
PPUBSECNOTE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPUBSECNOTE table
|
PSIMULATION-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMULATION table
|
PSPBYPERIOD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSPBYPERIOD table
|
PSTDPURORDS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTDPURORDS table
|
PSTKTRANORD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTKTRANORD table
|
PTEXTOBJECT-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTEXTOBJECT table
|
SEPMRACSOTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRACSOTP table
|
SEPMRAISOTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRAISOTP table
|
APURCONTRACT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURCONTRACT table
|
CABPPAYBATCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CABPPAYBATCH table
|
CBANKACCTREQ-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBANKACCTREQ table
|
CBCCHANGEDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBCCHANGEDOC table
|
CBILLFILELNK-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBILLFILELNK table
|
CBUPASUPLIER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUPASUPLIER table
|
CCNTRLPCONTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLPCONTP table
|
CCOMMITIOBJP-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMMITIOBJP table
|
CCOSTELEMENT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOSTELEMENT table
|
CCTRMAINTAIN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRMAINTAIN table
|
CFIGLITMCMPQ-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGLITMCMPQ table
|
CFMBUDGETANA-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMBUDGETANA table
|
CFSVHIERCOCD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFSVHIERCOCD table
|
CINSPCHARQTY-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPCHARQTY table
|
CINSUBCONQRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSUBCONQRY table
|
CJRNLENTRITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJRNLENTRITM table
|
CMDBPCHGPROC-CREATIONDATE table field - Master Data Change Process Creation Date
▼
Description: Master Data Change Process Creation Date Field Name: CREATIONDATE Data Element: MDC_PROCESS_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDBPCHGPROC table
|
CMMPRNOTOUCH-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRNOTOUCH table
|
CMNTRRFQITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNTRRFQITEM table
|
CONTRACTSOVP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CONTRACTSOVP table
|
CPAOBJPLNGWD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAOBJPLNGWD table
|
CPMNOTIFHEAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMNOTIFHEAD table
|
CPRCHINFOREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRCHINFOREC table
|
CPROJBSCINFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJBSCINFO table
|
CPROPENFORGR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROPENFORGR table
|
CQUOTWLF1852-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQUOTWLF1852 table
|
CREQTRACKCTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREQTRACKCTR table
|
CREQTRACKRFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREQTRACKRFQ table
|
CSEVCHGSCORE-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSEVCHGSCORE table
|
CSLEAFCIOBJP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLEAFCIOBJP table
|
CSLEAFFMOBJP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLEAFFMOBJP table
|
CSORDWLF1873-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSORDWLF1873 table
|
CSUPQUOFACET-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPQUOFACET table
|
CSWCSTRTDATA-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSWCSTRTDATA table
|
CWBSWITHVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWBSWITHVERS table
|
EPM_KPI_DATA-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EPM_KPI_DATA table
|
FISCDSCHGLOG-CREATIONDATE table field - Process Date
▼
Description: Process Date Field Name: CREATIONDATE Data Element: FIS_ETXDC_PDATE Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSCHGLOG table
|
IBAMREQEMAIL-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBAMREQEMAIL table
|
IBILLFILELNK-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBILLFILELNK table
|
IBKACCTREVER-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBKACCTREVER table
|
ICAINVDOCREV-CREATIONDATE table field - Date Reversal Request Was Created
▼
Description: Date Reversal Request Was Created Field Name: CREATIONDATE Data Element: REVTRIG_CRDAT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVDOCREV table
|
ICNTRLPCONTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCONTP table
|
ICONFOVPCHAR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICONFOVPCHAR table
|
ICVDOCSTRUCT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCSTRUCT table
|
IFIGLCOALIST-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLCOALIST table
|
IFMBDGECDOCB-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCB table
|
IINSPCHARQTY-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPCHARQTY table
|
IINSPOPCHVRS-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPCHVRS table
|
IINSUBCONTRG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSUBCONTRG table
|
IJRNLENTRITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJRNLENTRITM table
|
IMAINTITEMTO-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEMTO table
|
IMATORDNOTIF-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATORDNOTIF table
|
IOVRDUEPRCNF-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOVRDUEPRCNF table
|
IPROCBUSUSER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCBUSUSER table
|
IPROJMATCOMP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMATCOMP table
|
IQLTYNOTIFVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNOTIFVH table
|
IWBSELVALHLP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELVALHLP table
|
IWBSWITHVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSWITHVERS table
|
PCABPBUSLOCK-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCABPBUSLOCK table
|
PCCINTERELIM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCINTERELIM table
|
PEBWORDLOGHD-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBWORDLOGHD table
|
PFIBAKACCTH2-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIBAKACCTH2 table
|
PFMBDGECDOCB-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFMBDGECDOCB table
|
PMMIRPRCVAR1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMIRPRCVAR1 table
|
PMMPCPRCVAR1-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPCPRCVAR1 table
|
PMMPCPRCVAR2-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPCPRCVAR2 table
|
PMMPRNOTOUCH-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPRNOTOUCH table
|
PMMUNUSEDPC1-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMUNUSEDPC1 table
|
POVERDUECALC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POVERDUECALC table
|
POVERDUEPRED-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POVERDUEPRED table
|
POVRDUEPRCNF-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POVRDUEPRCNF table
|
PPOSTJOURNAL-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSTJOURNAL table
|
PPOSUPLRCONF-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSUPLRCONF table
|
PPURORDERSFS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDERSFS table
|
PSDSLSANALYT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSANALYT table
|
PWBSWITHVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWBSWITHVERS table
|
SEPMRAPOVWSO-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRAPOVWSO table
|
ASALESINQUIRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASALESINQUIRY table
|
CAPPLOFFUNDTP-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAPPLOFFUNDTP table
|
CBUDGETPDOBJP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUDGETPDOBJP table
|
CBUPACUSTOMER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUPACUSTOMER table
|
CCAPAYTSEARCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYTSEARCH table
|
CCHGRECREFPPO-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFPPO table
|
CCHGRECREFPPU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFPPU table
|
CCHGRECREFPSV-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFPSV table
|
CCHGRECREFROU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFROU table
|
CCHILDGRPFUND-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHILDGRPFUND table
|
CCLSPRCMDTYCD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCLSPRCMDTYCD table
|
CCLSPRLGLCTRL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCLSPRLGLCTRL table
|
CCNTRLCTRMASS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLCTRMASS table
|
CCSJRNLENTRTP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSJRNLENTRTP table
|
CDEFECTKEYFIG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTKEYFIG table
|
CFIFINSTMTKPI-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIFINSTMTKPI table
|
CFIGLACCBYFMA-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGLACCBYFMA table
|
CFIJELITBROWS-CREATIONDATE table field - Journal Entry Creation Date in Server Time
▼
Description: Journal Entry Creation Date in Server Time Field Name: CREATIONDATE Data Element: FIS_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIJELITBROWS table
|
CFMBUDOCIANQ1-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMBUDOCIANQ1 table
|
CFMFUNCAREATP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMFUNCAREATP table
|
CFUNDEDPROGTP-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNDEDPROGTP table
|
CGLACCTINCOCD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLACCTINCOCD table
|
CGMACDOCIANQ1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMACDOCIANQ1 table
|
CGROSSMARGKPI-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGROSSMARGKPI table
|
CINSUBCONCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSUBCONCUBE table
|
CINSUBCONOVWQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSUBCONOVWQ table
|
CIPMATLASSGMT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIPMATLASSGMT table
|
CMFGORDDEFREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEFREC table
|
CMMMATLPRCVAR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMMATLPRCVAR table
|
CMMPRNOTOUCH1-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRNOTOUCH1 table
|
CMMPROCPRCCMP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPROCPRCCMP table
|
CMMREQTYPEANA-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMREQTYPEANA table
|
CMNTNTFROOTIT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNTNTFROOTIT table
|
CMPEMFGSFILTQ-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPEMFGSFILTQ table
|
CMSTRPROJACTY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMSTRPROJACTY table
|
CPAYTMEDIAITM-CREATIONDATE table field - File Creation Date
▼
Description: File Creation Date Field Name: CREATIONDATE Data Element: TSDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYTMEDIAITM table
|
CPOCKPIALL365-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALL365 table
|
CPOCKPIALLMON-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALLMON table
|
CPODRAFTFORPR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPODRAFTFORPR table
|
CPRACCTASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRACCTASSGMT table
|
CPRMASSUPDATE-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRMASSUPDATE table
|
CPROJNTWKVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJNTWKVERS table
|
CPROJWITHVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJWITHVERS table
|
CPROJ_DLI_WIP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJ_DLI_WIP table
|
CPURCATTRANST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURCATTRANST table
|
CPURGINFRECFS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGINFRECFS table
|
CPURGQTAHDRWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGQTAHDRWD table
|
CPURRETDELITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURRETDELITM table
|
CQLTYTSKSTSVF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKSTSVF table
|
CQTNCHGDOCITM-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQTNCHGDOCITM table
|
CQUALWCASSGMT-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQUALWCASSGMT table
|
CRFQCHGDOCITM-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFQCHGDOCITM table
|
CRSHPROJASGCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSHPROJASGCD table
|
CSDMNTHUTLIZE-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMNTHUTLIZE table
|
CSETFUNDEDGRP-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETFUNDEDGRP table
|
CSETLEAFBPGRP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFBPGRP table
|
CSETLEAFFAGRP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFFAGRP table
|
CSPLEVLRSPEVL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSPLEVLRSPEVL table
|
CSSPGOODSMVMT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPGOODSMVMT table
|
CSUPEVTEMPMAN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPEVTEMPMAN table
|
CSUPLRQTNCOMP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRQTNCOMP table
|
CSUPPCONTRACT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPPCONTRACT table
|
CTECHOBJNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHOBJNOTIF table
|
CTOMAINTNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTOMAINTNOTIF table
|
CTOMAINTORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTOMAINTORDER table
|
CVARCONFSIMTP-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CVARCONFSIMTP table
|
FISCDSCHGPROJ-CREATIONDATE table field - Process Date
▼
Description: Process Date Field Name: CREATIONDATE Data Element: FIS_ETXDC_PDATE Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSCHGPROJ table
|
IABPPAYBTCHTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IABPPAYBTCHTP table
|
IAPPLOFFUNDTP-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAPPLOFFUNDTP table
|
IBKACCTREVCNT-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBKACCTREVCNT table
|
ICCINTCOELIMC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCINTCOELIMC table
|
ICCINTCORECNC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCINTCORECNC table
|
ICLSPRCMDTYCD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLSPRCMDTYCD table
|
ICLSPRLGLCTRL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLSPRLGLCTRL table
|
ICSJRNLENTRTP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSJRNLENTRTP table
|
IDEFECTKEYFIG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTKEYFIG table
|
IEBBLKRSNCHGS-CREATIONDATE table field - Contract Blocking Date
▼
Description: Contract Blocking Date Field Name: CREATIONDATE Data Element: E_BLOCKEDAT_VDM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBBLKRSNCHGS table
|
IFIACOSTELMNT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACOSTELMNT table
|
IFMBDGDOCITMB-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGDOCITMB table
|
IFMFUNCAREATP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNCAREATP table
|
IFUNCTLOCATTR-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNCTLOCATTR table
|
IFUNDEDPROGTP-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDEDPROGTP table
|
IINSPRESULTTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRESULTTP table
|
IINSTOBILLING-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSTOBILLING table
|
IMNTORDTOCUBE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNTORDTOCUBE table
|
IMPACTYDETAIL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPACTYDETAIL table
|
IMPCHKLSTACTY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPCHKLSTACTY table
|
IMPESFILTMECU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPESFILTMECU table
|
IMPISSCHGACTY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPISSCHGACTY table
|
IMPLANCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPLANCHNHIST table
|
IPAYTMEDIAITM-CREATIONDATE table field - File Creation Date
▼
Description: File Creation Date Field Name: CREATIONDATE Data Element: TSDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTMEDIAITM table
|
IPROJWITHVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJWITHVERS table
|
IPROJ_DLI_WIP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJ_DLI_WIP table
|
IPUBSECNOTETP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECNOTETP table
|
IPURREQNITMWD-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITMWD table
|
IQUALWCASSGMT-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQUALWCASSGMT table
|
ISDSLSANACUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSANACUBE table
|
IVARCONFSIMTP-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSIMTP table
|
IVARCONFSIMVH-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSIMVH table
|
NCHGRECREFPSV-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRECREFPSV table
|
NPRACCTASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NPRACCTASSGMT table
|
PAPLJOBSTATUS-CREATIONDATE table field - Date of job/step scheduling
▼
Description: Date of job/step scheduling Field Name: CREATIONDATE Data Element: BTCSDLDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLJOBSTATUS table
|
PCCINTERRECON-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCINTERRECON table
|
PCCRELDOCVAL2-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCRELDOCVAL2 table
|
PCCTRITEMMNTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTRITEMMNTR table
|
PCNTRLCTRITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLCTRITEM table
|
PCONFPRPLSMPL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONFPRPLSMPL table
|
PFNDNWITHRPT1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT1 table
|
PFNDNWITHRPT2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT2 table
|
PFNDNWITHRPT3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT3 table
|
PFNDNWITHRPT4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT4 table
|
PFNDNWITHRPT5-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT5 table
|
PFNDNWITHRPT6-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT6 table
|
PFNDNWITHRPT7-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT7 table
|
PFNDNWITHRPT8-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT8 table
|
PFNDNWTRPTS_2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWTRPTS_2 table
|
PFNDNWTRPTS_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWTRPTS_3 table
|
PFNDNWTRPTS_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWTRPTS_4 table
|
PMASSUPDATEPR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMASSUPDATEPR table
|
PMATOVERDUEPC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUEPC table
|
PMMMATLPRCVAR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMMATLPRCVAR table
|
PMMREQTYPEANA-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMREQTYPEANA table
|
PMPACTYDETAIL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPACTYDETAIL table
|
PNOTIFPARTNER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNOTIFPARTNER table
|
PPROJNTWKVERS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJNTWKVERS table
|
PPROJWITHVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJWITHVERS table
|
PPRSSPITEMEXT-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRSSPITEMEXT table
|
PPSNOTEHEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPSNOTEHEADER table
|
PRFQITEMSMNTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRFQITEMSMNTR table
|
PRSHPROJASGCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRSHPROJASGCD table
|
PSAVEDSIMDRFT-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSAVEDSIMDRFT table
|
PTRLTTRANSPOS-CREATIONDATE table field - Creation Date of the Operative Business Transaction
▼
Description: Creation Date of the Operative Business Transaction Field Name: CREATIONDATE Data Element: TPM_BT_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PTRLTTRANSPOS table
|
REPM_OPENDYS1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REPM_OPENDYS1 table
|
SEPMRAPPOCDAT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRAPPOCDAT table
|
/PF1/C_WAIT_EM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /PF1/DTE_BPE_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PF1/C_WAIT_EM table
|
CBSEHDGACTHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBSEHDGACTHIST table
|
CBUDGETDOCOBJP-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUDGETDOCOBJP table
|
CCADOCHEADERVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADOCHEADERVH table
|
CCAINVOVW_DISP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVOVW_DISP table
|
CCAWORKITEMCFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAWORKITEMCFO table
|
CCHGIMPNTWKDET-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGIMPNTWKDET table
|
CCHGRECREFSROU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFSROU table
|
CCHILDFUNDSCTR-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHILDFUNDSCTR table
|
CCHILDGRANTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHILDGRANTGRP table
|
CCLSPRISSRVCCD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCLSPRISSRVCCD table
|
CCLSPRTRIFNMBR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCLSPRTRIFNMBR table
|
CCOLPROCESSING-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOLPROCESSING table
|
CCOMMITITEMGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMMITITEMGRP table
|
CCOSTCTRCHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOSTCTRCHGDOC table
|
CCSJRNLENTRITP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSJRNLENTRITP table
|
CCTRMASSCHANGE-CREATIONDATE table field - Purchase Contract Date
▼
Description: Purchase Contract Date Field Name: CREATIONDATE Data Element: AEDAT_LL Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRMASSCHANGE table
|
CDEFECTANALYZE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTANALYZE table
|
CDEFECTSBYCODE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTSBYCODE table
|
CESJIQUOTATION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJIQUOTATION table
|
CESJIQUOTITEMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJIQUOTITEMQ table
|
CESJISLSORDERQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJISLSORDERQ table
|
CFGLISOPRQUERY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFGLISOPRQUERY table
|
CFIESTDCOSTRUN-CREATIONDATE table field - Date on Which Cost Estimate Was Created
▼
Description: Date on Which Cost Estimate Was Created Field Name: CREATIONDATE Data Element: CK_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIESTDCOSTRUN table
|
CFIGLLITMQ0001-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGLLITMQ0001 table
|
CFUNDEDPROGGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNDEDPROGGRP table
|
CFUNDSCENTERTP-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNDSCENTERTP table
|
CGRANTTOSPPROG-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRANTTOSPPROG table
|
CINJRNLVCHRQRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINJRNLVCHRQRY table
|
CINSPPLOPCHARC-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLOPCHARC table
|
CINSPRSLTMLTPL-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPRSLTMLTPL table
|
CINSPSUBRESREC-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSUBRESREC table
|
CLOCANALYQUERY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLOCANALYQUERY table
|
CMDGFINCRFLTRS-CREATIONDATE table field - Change Request Created On
▼
Description: Change Request Created On Field Name: CREATIONDATE Data Element: MDGOVCHGREQCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDGFINCRFLTRS table
|
CMDPRODCHGPROC-CREATIONDATE table field - Master Data Change Process Creation Date
▼
Description: Master Data Change Process Creation Date Field Name: CREATIONDATE Data Element: MDC_PROCESS_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDPRODCHGPROC table
|
CMDQPRODDETAIL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQPRODDETAIL table
|
CMILESTONEVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMILESTONEVERS table
|
CMMREQTYPEANA2-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMREQTYPEANA2 table
|
CMMSRCOFSUPPLY-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMSRCOFSUPPLY table
|
CMNTORDTOQUERY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNTORDTOQUERY table
|
CPARENTGRPFUND-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPARENTGRPFUND table
|
CPOCAGGPRCSTEP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCAGGPRCSTEP table
|
CPOCKPIALL365L-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALL365L table
|
CPOCKPIALL365T-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALL365T table
|
CPOSUPLRCONOBJ-CREATIONDATE table field - Creation Date of Confirmation
▼
Description: Creation Date of Confirmation Field Name: CREATIONDATE Data Element: BBERD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSUPLRCONOBJ table
|
CPRITEMDETAILS-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRITEMDETAILS table
|
CPRODVEROBJPAG-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODVEROBJPAG table
|
CPUBSSECNOTETP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSSECNOTETP table
|
CPURDOCPARTNER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURDOCPARTNER table
|
CPURGCHGDOCITM-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGCHGDOCITM table
|
CPURINFORECORG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURINFORECORG table
|
CQMISCHARANLYS-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQMISCHARANLYS table
|
CQUALMATASSGMT-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQUALMATASSGMT table
|
CSADL_VOC_CORR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_CORR table
|
CSADL_VOC_SOER-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOER table
|
CSADL_VOC_SOFT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOFT table
|
CSADL_VOC_SONM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SONM table
|
CSADL_VOC_SOPA-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOPA table
|
CSADL_VOC_SOPQ-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOPQ table
|
CSADL_VOC_SOPV-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOPV table
|
CSADL_VOC_SOSM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOSM table
|
CSCONTRWLF1851-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCONTRWLF1851 table
|
CSDMNTHLYUTLIZ-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMNTHLYUTLIZ table
|
CSETLEAFCMTGRP-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFCMTGRP table
|
CSSPPRMAINTHDR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPPRMAINTHDR table
|
CSUPLRQTNFACET-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRQTNFACET table
|
CTECHOBJFLATVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHOBJFLATVH table
|
CTECHOBJHIERVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHOBJHIERVH table
|
CVCHHLGRPCSTIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CVCHHLGRPCSTIC table
|
CWRKLOADREDIST-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWRKLOADREDIST table
|
ESH_L_CORRSPON-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CORRSPON table
|
FISCDSTRKDOC03-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSTRKDOC03 table
|
FISCDSTRKDOC10-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSTRKDOC10 table
|
IANALACCRPOSTG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IANALACCRPOSTG table
|
IANALACEVISFLT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IANALACEVISFLT table
|
IBANKACCOUNTTP-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKACCOUNTTP table
|
ICABOOOPBOMICS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABOOOPBOMICS table
|
ICHGLIFESTALOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHGLIFESTALOG table
|
ICLSPRISSRVCCD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLSPRISSRVCCD table
|
ICLSPRTRIFNMBR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLSPRTRIFNMBR table
|
ICONFOVPOBJDEP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: KNEDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICONFOVPOBJDEP table
|
IEQUIPMENTATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEQUIPMENTATTR table
|
IFUNDSCENTERTP-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDSCENTERTP table
|
IINSPRSLTVALTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRSLTVALTP table
|
IMAINTITEMDATA-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEMDATA table
|
IMAINTREVISION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTREVISION table
|
IMAINTTASKLIST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTASKLIST table
|
IMATOVERDUESIT-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATOVERDUESIT table
|
IMILESTONEVERS-CREATIONDATE table field - Milestone created on
▼
Description: Milestone created on Field Name: CREATIONDATE Data Element: MLST_DATEH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMILESTONEVERS table
|
IMNOTIFCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNOTIFCHNHIST table
|
IMORDERCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMORDERCHNHIST table
|
IMPBILLSUMMARY-CREATIONDATE table field - Master Project Invoice Creation Date
▼
Description: Master Project Invoice Creation Date Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPBILLSUMMARY table
|
IOBJDEPENDENCY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: KNEDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOBJDEPENDENCY table
|
IOPENCORRESPNC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOPENCORRESPNC table
|
IPMORDOPERDATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMORDOPERDATA table
|
IPROJMILESTONE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMILESTONE table
|
IPURREQNHEADER-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNHEADER table
|
IQMISCHARANLYS-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQMISCHARANLYS table
|
IQUALMATASSGMT-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQUALMATASSGMT table
|
ISDSLSANACUBE1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSANACUBE1 table
|
ISDSLSORDCONFC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSORDCONFC table
|
PANALACCRPOSTG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PANALACCRPOSTG table
|
PARBSITMPAYADV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARBSITMPAYADV table
|
PARPROM2PAYOVW-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARPROM2PAYOVW table
|
PCCFNDNWITHRPT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT table
|
PCCICRECONTHR1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR1 table
|
PCCICRECONTHR2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR2 table
|
PCCICRECONTHR3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR3 table
|
PCCICRECONTHR4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR4 table
|
PCCICRECONTHR5-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR5 table
|
PCCICRECONTHR6-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR6 table
|
PCCICRECONTHR7-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR7 table
|
PCCICRECONTHR8-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCICRECONTHR8 table
|
PCFIGLACCBYFMA-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCFIGLACCBYFMA table
|
PCHGDOCCCHAR32-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCHGDOCCCHAR32 table
|
PCLSPRFORKDATE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLSPRFORKDATE table
|
PCTRMASSCHANGE-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCTRMASSCHANGE table
|
PCTRPRPSLFDBKM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCTRPRPSLFDBKM table
|
PFNDNENHANCUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNENHANCUBE table
|
PGRSSMARGUNION-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRSSMARGUNION table
|
PMAINTTASKLIST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMAINTTASKLIST table
|
PMATOVERDUESIT-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESIT table
|
PMATOVRDSITPD2-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVRDSITPD2 table
|
PMILESTONEVERS-CREATIONDATE table field - Milestone created on
▼
Description: Milestone created on Field Name: CREATIONDATE Data Element: MLST_DATEH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMILESTONEVERS table
|
PMMCNTRITMMNTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCNTRITMMNTR table
|
PMMREQTYPEANA2-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMREQTYPEANA2 table
|
PMPESFILTMSTAG-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPESFILTMSTAG table
|
POPENCORRESPNC-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POPENCORRESPNC table
|
POVERDUESITBAS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POVERDUESITBAS table
|
PPROJFINSUMMRY-CREATIONDATE table field - Posting Date
▼
Description: Posting Date Field Name: CREATIONDATE Data Element: FIS_BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJFINSUMMRY table
|
PPROJ_DLI_WIP1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJ_DLI_WIP1 table
|
PPURCHASECTRWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCHASECTRWD table
|
PPURINFRECMASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURINFRECMASS table
|
REPM_OPENDAYSC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REPM_OPENDAYSC table
|
REPM_OPEN_SOC1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REPM_OPEN_SOC1 table
|
VDPOST_CONTROL-CREATIONDATE table field - Bill Creation Date
▼
Description: Bill Creation Date Field Name: CREATIONDATE Data Element: TB_BILL_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VDPOST_CONTROL table
|
/DMBE/IAUDITLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/IAUDITLOG table
|
ASALESQUOTATION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASALESQUOTATION table
|
CBUDGETPERIODTP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUDGETPERIODTP table
|
CCHGRCDOBJPGDOC-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGDOC table
|
CCHGRCDOBJPGPLS-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGPLS table
|
CCHILDFUNDEDGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHILDFUNDEDGRP table
|
CCLRDITMCORRPNC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCLRDITMCORRPNC table
|
CCOMMITITMCHILD-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMMITITMCHILD table
|
CCSMATRIXRPT10Q-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSMATRIXRPT10Q table
|
CCSMATRIXRPT30Q-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSMATRIXRPT30Q table
|
CCTRITMMASSUPDT-CREATIONDATE table field - Purchase Contract Date
▼
Description: Purchase Contract Date Field Name: CREATIONDATE Data Element: AEDAT_LL Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRITMMASSUPDT table
|
CDEBITMRWLF1988-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEBITMRWLF1988 table
|
CDEFSBYLOTORIGN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFSBYLOTORIGN table
|
CEBUTILSCONTRTP-CREATIONDATE table field - Contract Blocking Date
▼
Description: Contract Blocking Date Field Name: CREATIONDATE Data Element: E_BLOCKEDAT_VDM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBUTILSCONTRTP table
|
CESJISLSODRITMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJISLSODRITMQ table
|
CFIPRODCSTBOQRY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIPRODCSTBOQRY table
|
CFMBDGTPDCORETP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMBDGTPDCORETP table
|
CFMFUNCAREAOBJP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMFUNCAREAOBJP table
|
CFUNCTLLOCATION-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNCTLLOCATION table
|
CFUNDSCENTERGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNDSCENTERGRP table
|
CGLIOORDRENTRVF-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLIOORDRENTRVF table
|
CGMBDGTDOCIANQ1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMBDGTDOCIANQ1 table
|
CGMBDOCITM4OBJP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMBDOCITM4OBJP table
|
CGMBDOCITM4OBPR-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMBDOCITM4OBPR table
|
CGMBDOCITM4OBPU-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMBDOCITM4OBPU table
|
CGRANTTOSPCLASS-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRANTTOSPCLASS table
|
CINCSDOCWLF2430-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINCSDOCWLF2430 table
|
CINJRNLVCHRCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINJRNLVCHRCUBE table
|
CINJRNLVCHROVWQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINJRNLVCHROVWQ table
|
CINSPCHARKEYFIG-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPCHARKEYFIG table
|
CINSPSTKPOSTING-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSTKPOSTING table
|
CINSUBCONDUELST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSUBCONDUELST table
|
CMDCHGPROCMTABS-CREATIONDATE table field - Master Data Change Process Creation Date
▼
Description: Master Data Change Process Creation Date Field Name: CREATIONDATE Data Element: MDC_PROCESS_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDCHGPROCMTABS table
|
CMDPRCPROCMTABS-CREATIONDATE table field - Master Data Change Process Creation Date
▼
Description: Master Data Change Process Creation Date Field Name: CREATIONDATE Data Element: MDC_PROCESS_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDPRCPROCMTABS table
|
CMNGUNASSEBMPLS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VMP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNGUNASSEBMPLS table
|
CMNTRCNTRLPRITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNTRCNTRLPRITM table
|
CPARENTFUNDSCTR-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPARENTFUNDSCTR table
|
CPARENTGRANTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPARENTGRANTGRP table
|
CPOCKPIALL365TI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALL365TI table
|
CPPMPROJECTELEM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMPROJECTELEM table
|
CPROJPROCMTPRPO-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJPROCMTPRPO table
|
CPURGCATEGORYFS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGCATEGORYFS table
|
CPURGDOCITEMSPO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCITEMSPO table
|
CPURORDITEMMONI-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITEMMONI table
|
CPURORDSUPLCONF-CREATIONDATE table field - Creation Date of Confirmation
▼
Description: Creation Date of Confirmation Field Name: CREATIONDATE Data Element: BBERD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDSUPLCONF table
|
CPURREQITEMMNTR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQITEMMNTR table
|
CQLTYTSKASSGDVF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKASSGDVF table
|
CSADL_VOC_SOEUR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOEUR table
|
CSCHAGRMTITMMAS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: MMPUR_SES_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHAGRMTITMMAS table
|
CSCHEDGAGRMTHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHEDGAGRMTHDR table
|
CSDSLSORDCONFAQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSORDCONFAQ table
|
CSDSLSORDHDRQRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSORDHDRQRY table
|
CSETLEAFFUNDOBJ-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFFUNDOBJ table
|
CSLCQNREVALTRAN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLCQNREVALTRAN table
|
CSLEAFGRANTOBJP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLEAFGRANTOBJP table
|
CSUPACTTASKPROC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPACTTASKPROC table
|
CSUPLRBYPURGCAT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPLRBYPURGCAT table
|
CSWCSTRTDATA_SW-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSWCSTRTDATA_SW table
|
ESH_L_CLFNCLASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CLFNCLASS table
|
FISV_TRK_DOC_01-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_TRK_DOC_01 table
|
IBUDGETPERIODTP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUDGETPERIODTP table
|
ICAINTRSTNTCHDR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINTRSTNTCHDR table
|
ICAPAYTRUNADMIN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPAYTRUNADMIN table
|
ICCGRPRPTENHANC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCGRPRPTENHANC table
|
IFIBANKACCOUNTH-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKACCOUNTH table
|
IFIPRODCSTBOCUB-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPRODCSTBOCUB table
|
IFMBDGTPDCORETP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTPDCORETP table
|
IINSPCHARKEYFIG-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPCHARKEYFIG table
|
IINSUBCONDUELST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSUBCONDUELST table
|
IMATSTOCKORDNTF-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATSTOCKORDNTF table
|
IMPDEBITMEMOREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPDEBITMEMOREQ table
|
IPMTASKLISTDATA-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMTASKLISTDATA table
|
IPPMPROJECTELEM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMPROJECTELEM table
|
IPROJMATCOMPVER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMATCOMPVER table
|
IPROJPROCMTPRPO-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJPROCMTPRPO table
|
IQLTYINPROCMTTP-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINPROCMTTP table
|
IQUALWCASSGMTTP-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQUALWCASSGMTTP table
|
ISDSALESORDERHC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESORDERHC table
|
ISRVCDOCREVCUBE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCDOCREVCUBE table
|
ISTANDARDWBSELE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTANDARDWBSELE table
|
ITECHOBJCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITECHOBJCHNHIST table
|
IWBSELEMPRJCMPA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELEMPRJCMPA table
|
NCHGRCDOBJPGMAT-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRCDOBJPGMAT table
|
PCCFNDNWITHRPT1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT1 table
|
PCCFNDNWITHRPT2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT2 table
|
PCCFNDNWITHRPT3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT3 table
|
PCCFNDNWITHRPT4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT4 table
|
PCCFNDNWITHRPT5-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT5 table
|
PCCFNDNWITHRPT6-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT6 table
|
PCCFNDNWITHRPT7-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT7 table
|
PCCFNDNWITHRPT8-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPT8 table
|
PCCFNDNWITHRPTS-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCFNDNWITHRPTS table
|
PCSJRNLENTRUPLD-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCSJRNLENTRUPLD table
|
PFIBANKACCOUNTH-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIBANKACCOUNTH table
|
PFIPCCORDANDITM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPCCORDANDITM table
|
PFNDNENHAN2CUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNENHAN2CUBE table
|
PFNDNWITHRPT1_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT1_3 table
|
PFNDNWITHRPT1_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT1_4 table
|
PFNDNWITHRPT2_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT2_3 table
|
PFNDNWITHRPT2_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT2_4 table
|
PFNDNWITHRPT3_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT3_3 table
|
PFNDNWITHRPT3_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT3_4 table
|
PFNDNWITHRPT4_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT4_3 table
|
PFNDNWITHRPT4_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT4_4 table
|
PFNDNWITHRPT5_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT5_3 table
|
PFNDNWITHRPT5_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT5_4 table
|
PFNDNWITHRPT6_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT6_3 table
|
PFNDNWITHRPT6_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT6_4 table
|
PFNDNWITHRPT7_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT7_3 table
|
PFNDNWITHRPT7_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT7_4 table
|
PFNDNWITHRPT8_3-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT8_3 table
|
PFNDNWITHRPT8_4-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFNDNWITHRPT8_4 table
|
POVERDUESITBAS2-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POVERDUESITBAS2 table
|
PPOITEMSUPLRSIT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMSUPLRSIT table
|
PPROJPROCMTPRPO-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJPROCMTPRPO table
|
PREQNAVGAPPTIME-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQNAVGAPPTIME table
|
PSDSLSVOLBYYEAR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSVOLBYYEAR table
|
PSOIDLVPERFCARD-CREATIONDATE table field - Document Date (Date Received/Sent)
▼
Description: Document Date (Date Received/Sent) Field Name: CREATIONDATE Data Element: AUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSOIDLVPERFCARD table
|
V_MRP_PURCH_DOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_MRP_PURCH_DOC table
|
/DMBE/LASTCHANGE-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/LASTCHANGE table
|
AINSPRESULTVALUE-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPRESULTVALUE table
|
APSTGJRNLENTRITM-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APSTGJRNLENTRITM table
|
CAPPLOFFUNDFMOBJ-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAPPLOFFUNDFMOBJ table
|
CBANKACCTWITHREV-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBANKACCTWITHREV table
|
CBDGTPRDCHILDGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDGTPRDCHILDGRP table
|
CBUDGETPERIODGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUDGETPERIODGRP table
|
CBUDGTPRDPRNTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUDGTPRDPRNTGRP table
|
CCAPAYTSEARCHLOT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYTSEARCHLOT table
|
CCHGRECLIFSTATUS-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECLIFSTATUS table
|
CCNSLDTNJRNLENTR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNSLDTNJRNLENTR table
|
CCNTRLCTRITMMASS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLCTRITMMASS table
|
CCNTRLCTRITMMNTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLCTRITMMNTR table
|
CCOMMTITMPRNTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCOMMTITMPRNTGRP table
|
CCREDITMRWLF1989-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCREDITMRWLF1989 table
|
CCTRITEMACCTMONI-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRITEMACCTMONI table
|
CCUSTRETURNF1708-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCUSTRETURNF1708 table
|
CESJIBILLINGDOCQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJIBILLINGDOCQ table
|
CESJILEOUTBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJILEOUTBDELIV table
|
CFICCACTTYPQ0001-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFICCACTTYPQ0001 table
|
CFIINTORDERQ0001-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIINTORDERQ0001 table
|
CFIPRDTCOSTBYOAI-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIPRDTCOSTBYOAI table
|
CFIPRDTCOSTBYOR1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIPRDTCOSTBYOR1 table
|
CFIPRDTCOSTBYOR2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIPRDTCOSTBYOR2 table
|
CFIPRFTCTRCHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIPRFTCTRCHGDOC table
|
CFMFUNCNLACORETP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFMFUNCNLACORETP table
|
CFUNCAREACHLDGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNCAREACHLDGRP table
|
CFUNCAREAPRNTGRP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFUNCAREAPRNTGRP table
|
CINSPCHARQUANTCH-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPCHARQUANTCH table
|
CINSPORIGNDEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPORIGNDEFECT table
|
CINSPUSGEDESCSTK-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPUSGEDESCSTK table
|
CMDQLTYPRODBDRES-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYPRODBDRES table
|
CMDQLTYPRODSARES-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYPRODSARES table
|
CPARENTFUNDEDPRG-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPARENTFUNDEDPRG table
|
CPOCKPIALL365LIT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOCKPIALL365LIT table
|
CPOSUPLRCONFMAIN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSUPLRCONFMAIN table
|
CPROJMATCOMPVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJMATCOMPVERS table
|
CQLTYTSKDEFCATVF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKDEFCATVF table
|
CSADL_VOC_SOCALF-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOCALF table
|
CSADL_VOC_SOCURR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSADL_VOC_SOCURR table
|
CSCHAGRMTPARTNER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHAGRMTPARTNER table
|
CSCHDGAGRMTPRTNR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHDGAGRMTPRTNR table
|
CSDMNTHLYUTILIZE-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMNTHLYUTILIZE table
|
CSDOCWCUSTEXPPRC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDOCWCUSTEXPPRC table
|
CSETFUNDEDPRGOBJ-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETFUNDEDPRGOBJ table
|
CSETFUNDSCNTRGRP-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETFUNDSCNTRGRP table
|
CSETLEAFFCNTROBJ-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFFCNTROBJ table
|
CSETLEAFGRANTGRP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETLEAFGRANTGRP table
|
CSUPEVLTMPTRANST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPEVLTMPTRANST table
|
CTECHNICALOBJECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHNICALOBJECT table
|
EPM_DATA_COMMENT-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EPM_DATA_COMMENT table
|
ESH_L_CAPYLOTHDR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CAPYLOTHDR table
|
FISV_MREF_DOC_01-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_MREF_DOC_01 table
|
FISV_MREF_DOC_04-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_MREF_DOC_04 table
|
FISV_MREF_DOC_06-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_MREF_DOC_06 table
|
FISV_MREF_DOC_07-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_MREF_DOC_07 table
|
ICABPBUSLOCKHIST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABPBUSLOCKHIST table
|
ICACORRBALNOITEM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACORRBALNOITEM table
|
ICACORRESPNCITEM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACORRESPNCITEM table
|
ICAPRVDRCONTRCAP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRCAP table
|
ICCFNDNENHANCUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCFNDNENHANCUBE table
|
ICOPRDTCOSTBYORD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOPRDTCOSTBYORD table
|
IFIESTCOSTGRUNWS-CREATIONDATE table field - Date on Which Cost Estimate Was Created
▼
Description: Date on Which Cost Estimate Was Created Field Name: CREATIONDATE Data Element: CK_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIESTCOSTGRUNWS table
|
IFIPRDTCOSTBYOAI-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPRDTCOSTBYOAI table
|
IFMFUNCNLACORETP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNCNLACORETP table
|
IINSPCHARQUANTCH-CREATIONDATE table field - Result Recorded On
▼
Description: Result Recorded On Field Name: CREATIONDATE Data Element: VDM_QMRSLTRECGDTE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPCHARQUANTCH table
|
IINSPPLOPCHARCTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLOPCHARCTP table
|
ILOCANALYSISCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOCANALYSISCUBE table
|
IMNTORDHISTECOBJ-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNTORDHISTECOBJ table
|
IPMTSKLISTOPDATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMTSKLISTOPDATA table
|
IPROJMATCMPWVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMATCMPWVERS table
|
IPROJNETWITHVERS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJNETWITHVERS table
|
IQINFRCDINPROCUN-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQINFRCDINPROCUN table
|
IQLTYINFORECPROC-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINFORECPROC table
|
IQUALMATASSGMTTP-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQUALMATASSGMTTP table
|
ISDSLSDOCIFLFMTA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCIFLFMTA table
|
MMPUR_CPRPSL_FDB-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CPRPSL_FDB table
|
PARPROCFLOWBLDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARPROCFLOWBLDOC table
|
PARPROCFLOWSDDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARPROCFLOWSDDOC table
|
PARPROM2PAYOVW01-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARPROM2PAYOVW01 table
|
PCAPAYMENTSEARCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCAPAYMENTSEARCH table
|
PCHGDOCCHARTORAW-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCHGDOCCHARTORAW table
|
PCLRDITMCORRPNC1-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRDITMCORRPNC1 table
|
PENGPROJCHNGEDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENGPROJCHNGEDOC table
|
PFIPRODCOSTBYOAI-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPRODCOSTBYOAI table
|
PMATOVERDUESITLC-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESITLC table
|
PMMPCHGEDOCITEM2-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPCHGEDOCITEM2 table
|
PPRCHINFORECORDS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCHINFORECORDS table
|
PPRDSTORAGELOCWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRDSTORAGELOCWD table
|
PPROJMATCOMPVERS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJMATCOMPVERS table
|
PPROJ_DLIWIP_BAS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJ_DLIWIP_BAS table
|
PSCHEDGAGRMTORDS-CREATIONDATE table field - Creation Date of Confirmation
▼
Description: Creation Date of Confirmation Field Name: CREATIONDATE Data Element: BBERD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSCHEDGAGRMTORDS table
|
PSDDPLSLSDOCGRPG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDDPLSLSDOCGRPG table
|
PSDSLSDOCIFLFMTA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCIFLFMTA table
|
EBAN-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN table
|
EKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPO table
|
BEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BEKPO table
|
CAGRC-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAGRC table
|
EBAN1-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN1 table
|
EBANU-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBANU table
|
EBANW-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBANW table
|
FEBAN-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FEBAN table
|
ICIHI-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICIHI table
|
IGMIA-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMIA table
|
IPOAO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOAO table
|
PDCD4-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDCD4 table
|
UEBAN-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UEBAN table
|
UEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UEKPO table
|
ANLA_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ANLA_D table
|
CAGRIU-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAGRIU table
|
CBRNFS-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBRNFS table
|
CIPPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIPPRT table
|
CMDQBP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQBP table
|
CRPOVH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRPOVH table
|
IGMIAB-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMIAB table
|
IHDRCA-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHDRCA table
|
IMMQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTN table
|
IMMRFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQ table
|
IVCHOD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: KNEDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHOD table
|
IVLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVLIST table
|
MPLA_D-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPLA_D table
|
PCLRLF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRLF table
|
PCLRPC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRPC table
|
PCLRPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRPO table
|
PCLRSO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRSO table
|
PCLRTO-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRTO table
|
PFMKYF-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFMKYF table
|
PIOCHL-CREATIONDATE table field - Changed on
▼
Description: Changed on Field Name: CREATIONDATE Data Element: CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIOCHL table
|
PSTX_D-CREATIONDATE table field - PS Text created on
▼
Description: PS Text created on Field Name: CREATIONDATE Data Element: DATEH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSTX_D table
|
ADEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADEFECT table
|
ARFQHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARFQHDR table
|
BDIEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BDIEKPO table
|
CCWFREL-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCWFREL table
|
CDEFREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFREC table
|
CENGSNP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENGSNP table
|
CGROITD-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGROITD table
|
CLOADID-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLOADID table
|
CORGMCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CORGMCD table
|
IBUPATP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPATP table
|
ICCFNDN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCFNDN table
|
IDEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECT table
|
IORGMCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORGMCD table
|
IPCLRDQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRDQ table
|
IPCLRLF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRLF table
|
IPCLRPC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRPC table
|
IPCLRPO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRPO table
|
IPCLRSO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRSO table
|
IPCLRTO-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRTO table
|
IPLSBSC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VMP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPLSBSC table
|
IPOACSO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOACSO table
|
IPRITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEM table
|
IPSTEXT-CREATIONDATE table field - PS Text created on
▼
Description: PS Text created on Field Name: CREATIONDATE Data Element: DATEH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSTEXT table
|
IRTGACT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGACT table
|
IRTGHDR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGHDR table
|
MITEM_D-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MITEM_D table
|
PASQNCD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PASQNCD table
|
PCLRPRO-CREATIONDATE table field - Actual release date
▼
Description: Actual release date Field Name: CREATIONDATE Data Element: CO_FTRMI Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLRPRO table
|
PGRCDED-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRCDED table
|
PIOICHL-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIOICHL table
|
PIOSCHL-CREATIONDATE table field - Changed on
▼
Description: Changed on Field Name: CREATIONDATE Data Element: CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIOSCHL table
|
PMNTOBD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTOBD table
|
PPURCTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCTR table
|
QTASK_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QTASK_D table
|
REFEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REFEKPO table
|
RFCADOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFCADOC table
|
ACABPINV-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACABPINV table
|
ACABPPAY-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACABPPAY table
|
ALLOCTAG-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: FCO_TAG_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCTAG table
|
APRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APRODUCT table
|
APURGQTA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURGQTA table
|
ASDBDREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDBDREQ table
|
ATPC_STO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATPC_STO table
|
BADI_EKP-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BADI_EKP table
|
BADI_POT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BADI_POT table
|
CAGROII2-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAGROII2 table
|
CCUSTRET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCUSTRET table
|
CGRCMLTP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCMLTP table
|
CGRCP006-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCP006 table
|
CISULOSS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CISULOSS table
|
COPORDOP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COPORDOP table
|
CPRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODUCT table
|
CQLTYFAI-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYFAI table
|
CRTMOLOG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTMOLOG table
|
CSDBDRWL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBDRWL table
|
CSDMCCMR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCCMR table
|
CWUPCSOI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWUPCSOI table
|
EBAN_MEM-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN_MEM table
|
EBAN_VSR-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN_VSR table
|
EKPODATA-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPODATA table
|
ESH_B_CC-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_B_CC table
|
ESH_N_CC-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_N_CC table
|
ESH_S_CC-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_S_CC table
|
EXPD_OBJ-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_OBJ table
|
FCLMCOND-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLMCOND table
|
IASSETTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IASSETTP table
|
IBUPAREL-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPAREL table
|
ICADCDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADCDOC table
|
ICHARTBR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHARTBR table
|
IDMETREE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMETREE table
|
IEFDCONS-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDCONS table
|
IEFDITEM-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDITEM table
|
IFMEAHDR-CREATIONDATE table field - Date Created
▼
Description: Date Created Field Name: CREATIONDATE Data Element: PLMT_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEAHDR table
|
IFMEATSK-CREATIONDATE table field - Date When the Object Was Created
▼
Description: Date When the Object Was Created Field Name: CREATIONDATE Data Element: CGPL_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEATSK table
|
IGLACOCD-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGLACOCD table
|
IGMGRANT-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMGRANT table
|
IGMIACOI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMIACOI table
|
IINSPPLV-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLV table
|
IIPOPPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPOPPRT table
|
IIPPRTTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPPRTTP table
|
IMCFNDN2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDN2 table
|
IMDQBUPA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDQBUPA table
|
IMEASDOC-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEASDOC table
|
IMPBATCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPBATCH table
|
INGCCHR1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR1 table
|
INGCCHR2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR2 table
|
INGCCLS1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLS1 table
|
INGCCLS6-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCLS6 table
|
IORISITU-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORISITU table
|
IP2PATTR-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IP2PATTR table
|
IPCLRPRO-CREATIONDATE table field - Actual release date
▼
Description: Actual release date Field Name: CREATIONDATE Data Element: CO_FTRMI Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCLRPRO table
|
IPPPRTMD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPPRTMD table
|
IPRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODUCT table
|
IPROJECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJECT table
|
IQLTYFAI-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYFAI table
|
IQLTYTSK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSK table
|
IRTMOLOG-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTMOLOG table
|
ISDSQCRA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSQCRA table
|
MASSEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSEKPO table
|
MPEV_CER-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEV_CER table
|
PCNASTCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNASTCD table
|
PCRLIMTR-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCRLIMTR table
|
PGRCSODD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRCSODD table
|
PHBPRITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHBPRITM table
|
PIGMIACP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIGMIACP table
|
PMNGPRPO-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNGPRPO table
|
PRD_ROOT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRD_ROOT table
|
PRTMOLOG-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTMOLOG table
|
PSNOTETP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSNOTETP table
|
PWUPCSOI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWUPCSOI table
|
QIPPRT_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPPRT_D table
|
VICARG_D-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VICARG_D table
|
VICNCN_D-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VICNCN_D table
|
WB2_EKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_EKPO table
|
ACABPINVI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACABPINVI table
|
ACABPPAYI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACABPPAYI table
|
ACUSTOMER-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACUSTOMER table
|
AHUHDRDLV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AHUHDRDLV table
|
APAYTADVC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APAYTADVC table
|
APROJECT2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APROJECT2 table
|
APURGSRCE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURGSRCE table
|
ASDBDITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDBDITEM table
|
ASUPPLIER-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASUPPLIER table
|
ATPC_VBEP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATPC_VBEP table
|
BANKACCWD-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BANKACCWD table
|
BAPICATS2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CATS_ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPICATS2 table
|
BSSP_S_BP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BSSP_S_BP table
|
CARUNRULE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SUP_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CARUNRULE table
|
CBSPSLOVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBSPSLOVH table
|
CBUPAREL2-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUPAREL2 table
|
CCHGRECTP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECTP table
|
CCTRACCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRACCVH table
|
CCWFRELRW-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCWFRELRW table
|
CDELVNOTE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDELVNOTE table
|
CGRCNPSOR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNPSOR table
|
CINSPPLOP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLOP table
|
CINSPPLTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLTP table
|
CISUFRAUD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CISUFRAUD table
|
CJITSHPQV-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJITSHPQV table
|
CMMPURHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURHDR table
|
CMMRFQENH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMRFQENH table
|
CMPAFILES-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPAFILES table
|
CPRDDCSTL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDDCSTL table
|
CPURORDGR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDGR table
|
CSAMPLEOP-CREATIONDATE table field - System Date When Material Sample Was Created
▼
Description: System Date When Material Sample Was Created Field Name: CREATIONDATE Data Element: QPRS_ANLDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSAMPLEOP table
|
CSCHHDRFS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHHDRFS table
|
CSIGNCARD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSIGNCARD table
|
CSPRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSPRODUCT table
|
CSSDDOCVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSDDOCVH table
|
CTRDCLSPR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRDCLSPR table
|
CWUPCPROJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWUPCPROJ table
|
DPAYC_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DPAYC_GFN table
|
E1BPCATS2-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPCATS2 table
|
ESH_L_RFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_RFQ table
|
ESH_U_RFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_RFQ table
|
EXPD_LINE-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_LINE table
|
FKKKO_GFN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKKO_GFN table
|
FKKVK_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKVK_GFN table
|
IACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACCDOCCD table
|
ICABITREV-CREATIONDATE table field - Creation Date of Reversal Request for Billable Items
▼
Description: Creation Date of Reversal Request for Billable Items Field Name: CREATIONDATE Data Element: BITREVTRIG_CRDATE_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABITREV table
|
ICAP__VH1-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAP__VH1 table
|
ICASDRDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASDRDOC table
|
ICNDNCNTR-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNDNCNTR table
|
ICNTRLQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLQTN table
|
ICOMMITEM-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOMMITEM table
|
IDEFECTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTTP table
|
IDMECTREE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMECTREE table
|
IEFDCONSB-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDCONSB table
|
IEFDITEMB-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDITEMB table
|
IFIXASSET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIXASSET table
|
IFMEANDRT-CREATIONDATE table field - Date When the Object Was Created
▼
Description: Date When the Object Was Created Field Name: CREATIONDATE Data Element: CGPL_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEANDRT table
|
IFMFYCDOC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFYCDOC table
|
IGLACCTCY-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGLACCTCY table
|
IGLACOADI-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGLACOADI table
|
IGLACOATP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGLACOATP table
|
IGMACDOCI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMACDOCI table
|
IHEADERTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHEADERTP table
|
IINSPPLTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLTP table
|
IIPMATLTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPMATLTP table
|
IITEMDATA-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IITEMDATA table
|
IJITSHPQV-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJITSHPQV table
|
IMATSTLOC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATSTLOC table
|
IMCFNDN01-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDN01 table
|
IMCRPT01C-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCRPT01C table
|
IMFGORDER-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDER table
|
IMMQTNENH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNENH table
|
IMMRFQENH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQENH table
|
IMPAFILES-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPAFILES table
|
IMPMEMBER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /CPD/CPM_CREATEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPMEMBER table
|
IMTITMOBJ-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTITMOBJ table
|
INEWFRAUD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INEWFRAUD table
|
INGCCHR20-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INGCCHR20 table
|
INOTIFACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFACT table
|
INOTIFITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITM table
|
INOTIFPAR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFPAR table
|
INOTIFTSK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSK table
|
IPASQNCTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPASQNCTP table
|
IPAYTADVC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTADVC table
|
IPOACSOTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOACSOTP table
|
IQULTYTSK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQULTYTSK table
|
IRFMMPLND-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMPLND table
|
IRFMMPROD-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMPROD table
|
IRFMSDITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSDITM table
|
IRTLPROMN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTLPROMN table
|
ISASSETTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISASSETTP table
|
ISDEXCTDY-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEXCTDY table
|
ISIGNCARD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISIGNCARD table
|
ITRDCLSPR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRDCLSPR table
|
IVCHHLGRP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHHLGRP table
|
IVCHODBSC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: KNEDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHODBSC table
|
MEOUT_ABT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUT_ABT table
|
MEPI_EBAN-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPI_EBAN table
|
MPES_QMFE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_QMFE table
|
MPPURSL_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPPURSL_D table
|
OSPWEMAIL-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: OSPWDATE_TIME Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWEMAIL table
|
PACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACCDOCCD table
|
PCONFPROD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONFPROD table
|
PFIXASSET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIXASSET table
|
PFXDASSET-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFXDASSET table
|
PMLSTATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMLSTATTR table
|
PNEMPLOYE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNEMPLOYE table
|
PNGCCHR13-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNGCCHR13 table
|
POEMPLOYE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POEMPLOYE table
|
PPOREQFLD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOREQFLD table
|
PPOSFLOWS-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSFLOWS table
|
PPRODUCTD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRODUCTD table
|
PPROJATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJATTR table
|
PPURREQN1-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQN1 table
|
PPURREQN2-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQN2 table
|
PQULTYTSK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PQULTYTSK table
|
PRACCJOIN-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACCJOIN table
|
PROD_ROOT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_ROOT table
|
PSDDTCALC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDDTCALC table
|
PUEMPLOYE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUEMPLOYE table
|
PWLF_WBRK-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWLF_WBRK table
|
PWLF_WBRP-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWLF_WBRP table
|
PWUPCPROJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWUPCPROJ table
|
QDEFECT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDEFECT_D table
|
QINSPPL_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPPL_D table
|
QIPMATL_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPMATL_D table
|
RCNDNCNTR-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNDNCNTR table
|
RCNTRLQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLQTN table
|
REBDPRULE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBDPRULE table
|
ALLOCTAGTP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: FCO_TAG_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOCTAGTP table
|
ALLOTAGNTP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: FCO_TAG_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ALLOTAGNTP table
|
APURINFREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURINFREC table
|
ARUNRULE_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SUP_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUNRULE_D table
|
ATPC_UNION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATPC_UNION table
|
AUFK_DRAFT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUFK_DRAFT table
|
AVIK_DRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AVIK_DRAFT table
|
BUPA_REL_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_REL_D table
|
CBDLIF0798-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDLIF0798 table
|
CBDOCF0797-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCF0797 table
|
CBPPOPOVER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBPPOPOVER table
|
CCACFOCORR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCACFOCORR table
|
CCADCDOCTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADCDOCTP table
|
CCAINV_CFC-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINV_CFC table
|
CCAMYOPNWL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAMYOPNWL table
|
CCAMYWLITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAMYWLITM table
|
CCASDREQTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCASDREQTP table
|
CCONTRWFIN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCONTRWFIN table
|
CDEFECTFDP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTFDP table
|
CDEFECTMNG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTMNG table
|
CEXTPRITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXTPRITEM table
|
CGRCFALIFE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCFALIFE table
|
CGRCWBSAUC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCWBSAUC table
|
CISUFRAUDV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CISUFRAUDV table
|
CLCMCHGDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLCMCHGDOC table
|
CMFGORDDEF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEF table
|
CNTRLQTN_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLQTN_D table
|
COPTECHOBJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COPTECHOBJ table
|
CPAYFRTREE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYFRTREE table
|
CPCCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCCHNGLOG table
|
CPCHIERHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCHIERHDR table
|
CPIRPRCOND-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPIRPRCOND table
|
CPRDSTRSTL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDSTRSTL table
|
CRECIPEOVP-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRECIPEOVP table
|
CSDREQPROC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDREQPROC table
|
CSKB_DRAFT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSKB_DRAFT table
|
CSLA_DRAFT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLA_DRAFT table
|
CSUCURROPG-CREATIONDATE table field - Created On Date
▼
Description: Created On Date Field Name: CREATIONDATE Data Element: /PLMB/GSS_CREATED_ON_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUCURROPG table
|
CWUPCGROUP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWUPCGROUP table
|
DFKKPP_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKPP_GFN table
|
DFKKRK_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKRK_GFN table
|
DMECD_TREE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DMECD_TREE table
|
EINR_S_POT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EINR_S_POT table
|
ESH_L_CQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CQTN table
|
ESH_U_CQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CQTN table
|
EWAALYCCOL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWAALYCCOL table
|
EWAALYCCON-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWAALYCCON table
|
EXPD_INPUT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_INPUT table
|
EXTREQBANF-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXTREQBANF table
|
FNDEIFEBAN-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFEBAN table
|
FNDEIFEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFEKPO table
|
IACTLOGPRD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACTLOGPRD table
|
IBANKFORBP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT_BF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKFORBP table
|
IBOORELSHP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOORELSHP table
|
IBPPOPOVER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPPOPOVER table
|
IBPPROCESS-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPPROCESS table
|
ICADCDOCTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADCDOCTP table
|
ICAINV_CFC-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINV_CFC table
|
ICASDREQTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASDREQTP table
|
ICCCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCCHNGLOG table
|
ICCGRPRPTC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCGRPRPTC table
|
ICHANGEDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHANGEDOC table
|
ICMMROBJHD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMROBJHD table
|
ICNTRLPCON-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCON table
|
ICOMMITEMB-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICOMMITEMB table
|
ICPURORDTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPURORDTP table
|
ICSHCONCNT-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSHCONCNT table
|
ICTRPRTNRS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRPRTNRS table
|
IDEFECTUNI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTUNI table
|
IEQUIPMENT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEQUIPMENT table
|
IFMBDGTDOC-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTDOC table
|
IGLACOCDTP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGLACOCDTP table
|
IGMACDOCIB-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMACDOCIB table
|
IGMBDGTDOC-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMBDGTDOC table
|
IHEADERTBR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHEADERTBR table
|
IIPLNOPVRS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IIPLNOPVRS table
|
IMAINTITEM-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEM table
|
IMAINTPLAN-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTPLAN table
|
IMATDOCREC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCREC table
|
IMCFNDNPER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDNPER table
|
IMCFNDNYTD-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDNYTD table
|
IMEASPOINT-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEASPOINT table
|
IMFGCERTTP-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGCERTTP table
|
IPAYTMEDIA-CREATIONDATE table field - File Creation Date
▼
Description: File Creation Date Field Name: CREATIONDATE Data Element: TSDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTMEDIA table
|
IPOCONFAPI-CREATIONDATE table field - Creation Date of Confirmation
▼
Description: Creation Date of Confirmation Field Name: CREATIONDATE Data Element: BBERD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOCONFAPI table
|
IPPMISCPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMISCPRT table
|
IPPMSRGPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMSRGPRT table
|
IPPREMCONF-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SA_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPREMCONF table
|
IPURDOCHED-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURDOCHED table
|
IPURINFREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURINFREC table
|
IQLTYFAITP-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYFAITP table
|
IQLTYNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNOTIF table
|
IQLTYTSKTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSKTP table
|
IQNOTIFACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFACT table
|
IQNOTIFPAR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFPAR table
|
IQNOTIFTSK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFTSK table
|
IRECDCFOBJ-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECDCFOBJ table
|
IRECDCFPAY-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECDCFPAY table
|
IREDOCHEAD-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREDOCHEAD table
|
IRPTVCODET-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRPTVCODET table
|
ISDCOLPROC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCOLPROC table
|
ISDSLSINQY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSINQY table
|
ISDSLSQTAN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTAN table
|
ISETHEADER-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETHEADER table
|
ISOFSLSORD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISOFSLSORD table
|
IWLFSMTDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDOC table
|
MDC_BUT000-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDC_BUT000 table
|
MMQTNENH_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMQTNENH_D table
|
MMRFQENH_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMRFQENH_D table
|
PALLOCOBJD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOCOBJD table
|
PEACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEACCDOCCD table
|
PEBPSTRULE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPSTRULE table
|
PEHSSRCCDI-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEHSSRCCDI table
|
PENTPRJPLN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENTPRJPLN table
|
PFLWUPACTN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFLWUPACTN table
|
PICHISTORY-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PICHISTORY table
|
PIJELOGPRE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIJELOGPRE table
|
PINVINBAUT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PINVINBAUT table
|
PMFGICHIST-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGICHIST table
|
PMMPOITMDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOITMDR table
|
PMMPRNOTOU-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPRNOTOU table
|
POACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POACCDOCCD table
|
PPACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPACCDOCCD table
|
PPCCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPCCHNGLOG table
|
PPOITEMENH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMENH table
|
PPRCALCAGE-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCALCAGE table
|
PPRFIRSTPO-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRFIRSTPO table
|
PPRJDMNDPO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJDMNDPO table
|
PPURORDITM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITM table
|
PRACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACCDOCCD table
|
PRACCTWI_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACCTWI_D table
|
PSACCDOCCD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSACCDOCCD table
|
PSBRFMSGTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSBRFMSGTP table
|
PSUPINVAUT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSUPINVAUT table
|
PURORDTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURORDTP_D table
|
PWCBCCKONH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWCBCCKONH table
|
PWRKPURDOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWRKPURDOC table
|
QINSMETH_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSMETH_D table
|
RCNTRLPCON-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLPCON table
|
RFCADOCITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFCADOCITM table
|
RPROJECTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPROJECTTP table
|
SKA1_DRAFT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SKA1_DRAFT table
|
SKB1_DRAFT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SKB1_DRAFT table
|
SLIM3_S_PA-CREATIONDATE table field - Field of type DATS
▼
Description: Field of type DATS Field Name: CREATIONDATE Data Element: DATS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SLIM3_S_PA table
|
VFCLMBAHVH-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLMBAHVH table
|
ACNTRLPCTRH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACNTRLPCTRH table
|
AFICCACTTYP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFICCACTTYP table
|
AINSPMETHOD-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPMETHOD table
|
AINSPSUBSET-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPSUBSET table
|
AMATDOCHEAD-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AMATDOCHEAD table
|
ASALESORDER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASALESORDER table
|
ASEASONTEXT-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONTEXT table
|
ASOWTHOCHRG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASOWTHOCHRG table
|
ATPC_STO_10-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATPC_STO_10 table
|
AVMSINVOICE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AVMSINVOICE table
|
BUPA_ROOT_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_ROOT_D table
|
CADISPDOC_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CADISPDOC_D table
|
CAPPFPOITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAPPFPOITEM table
|
CBNKBTCHSIT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBNKBTCHSIT table
|
CBRVERIFYNF-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBRVERIFYNF table
|
CCABUSTRANS-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANS table
|
CCADEASTCHG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADEASTCHG table
|
CCCACTTYPTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCCACTTYPTP table
|
CCFINRPOACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCFINRPOACC table
|
CCFINRPODET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCFINRPODET table
|
CCHGRECDCHL-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECDCHL table
|
CCNTRLQTNTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLQTNTP table
|
CCONDCNTRWI-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCONDCNTRWI table
|
CDDFPRODNAT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFPRODNAT table
|
CDEFECTTFDP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTTFDP table
|
CENGSNPEBOM-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENGSNPEBOM table
|
CFASSETLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFASSETLIST table
|
CFRAUDITEMS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFRAUDITEMS table
|
CGBPURREQWL-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGBPURREQWL table
|
CGLCNGLGOVW-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGLCNGLGOVW table
|
CGMBDACTANQ-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMBDACTANQ table
|
CICLNOTEINQ-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CICLNOTEINQ table
|
CINSPRESHVL-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPRESHVL table
|
CINSPSUBSET-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSUBSET table
|
CMLSGRAPHOV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMLSGRAPHOV table
|
CMMPRITMDEX-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRITMDEX table
|
CNOSAFTHEAD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOSAFTHEAD table
|
CNOTDPTDPMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOTDPTDPMT table
|
CNTRLPCTP_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLPCTP_D table
|
COUTREQITEM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COUTREQITEM table
|
CPAYFRCTREE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAYFRCTREE table
|
CPIRPOLMASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPIRPOLMASS table
|
CPIRSUPRGCN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPIRSUPRGCN table
|
CPURORDTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDTP_D table
|
CRCPCURROPG-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPCURROPG table
|
CRCPFINDRES-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPFINDRES table
|
CRFDYODELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFDYODELIV table
|
CRFMSOPMITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMSOPMITM table
|
CRFQCOMPARE-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFQCOMPARE table
|
CSDMCCMRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCCMRITM table
|
CSDMCSLSORD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSORD table
|
CSDMCWSCHDL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCWSCHDL table
|
CSPRODUCT_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSPRODUCT_D table
|
CTRPRTNRS_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRPRTNRS_D table
|
CWLFSDOCDEX-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSDOCDEX table
|
DFKKCMS_GFN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKCMS_GFN table
|
DFKKFAD_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKFAD_GFN table
|
DFKKRDI_GFN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKRDI_GFN table
|
EKPO_SPLITT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPO_SPLITT table
|
ESH_L_FAREA-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_FAREA table
|
ESH_L_GRANT-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_GRANT table
|
ESH_U_FAREA-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_FAREA table
|
ESH_U_GRANT-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_GRANT table
|
FAAVASSETS4-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAAVASSETS4 table
|
FCMLREPEKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCMLREPEKPO table
|
FITAXMAPDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FITAXMAPDOC table
|
FKK_SEC_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_SEC_GFN table
|
IAINOBJLINK-CREATIONDATE table field - Time at which object was created
▼
Description: Time at which object was created Field Name: CREATIONDATE Data Element: TSTRCREATS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAINOBJLINK table
|
IAPPLOFFUND-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAPPLOFFUND table
|
IARUNRULETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SUP_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IARUNRULETP table
|
IBANKACCTWR-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKACCTWR table
|
IBNKBTCHSIT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBNKBTCHSIT table
|
IBUPARELTP2-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUPARELTP2 table
|
ICABUSTRANS-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABUSTRANS table
|
ICACREDHITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACREDHITM table
|
ICADCFLLWUP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADCFLLWUP table
|
ICAINVCFCTP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINVCFCTP table
|
ICASCRTYDEP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASCRTYDEP table
|
ICCACTTYPTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCACTTYPTP table
|
ICCFNDNCUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCFNDNCUBE table
|
ICCRNLENTRC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICCRNLENTRC table
|
ICECHTACCTS-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICECHTACCTS table
|
ICFGGROUPWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFGGROUPWD table
|
ICFINCIROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINCIROOT table
|
ICFINPOROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINPOROOT table
|
ICFINRPOACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRPOACC table
|
ICFINSIROOT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINSIROOT table
|
ICFINSOITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINSOITEM table
|
ICFINSOROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINSOROOT table
|
ICNTRLQTNTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLQTNTP table
|
ICSHCCNBASE-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSHCCNBASE table
|
IEBOVHDETBP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBOVHDETBP table
|
IEFDOCUMENT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDOCUMENT table
|
IENTPRJCOST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IENTPRJCOST table
|
IFASSETLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFASSETLIST table
|
IFICCACTTYP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICCACTTYP table
|
IFIGLGRPCOA-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLGRPCOA table
|
IFIPCCORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPCCORDER table
|
IFIXASSETTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIXASSETTP table
|
IFMBDGECESH-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECESH table
|
IFMFUNCAREA-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNCAREA table
|
IGHOMEASDOC-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGHOMEASDOC table
|
IGMBDACTANC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMBDACTANC table
|
IGMBDCHGITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMBDCHGITM table
|
IGMSPPROGCL-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMSPPROGCL table
|
IICLTASKAPP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IICLTASKAPP table
|
IINSPLOTATT-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: SO_DAT_CR Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPLOTATT table
|
IINSPLOTURL-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: SO_DAT_CR Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPLOTURL table
|
IINSPPLOPTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLOPTP table
|
IINSPRESULT-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRESULT table
|
IINSPSUBSET-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSET table
|
ILEDELIVDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEDELIVDOC table
|
ILEINBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEINBDELIV table
|
IMAINTNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIF table
|
IMAINTORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDER table
|
IMCFNDNCUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDNCUBE table
|
IMMQTNAPI01-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMQTNAPI01 table
|
IMMRFQAPI01-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQAPI01 table
|
IMMRFQENHWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMRFQENHWD table
|
IMMVALNHIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMVALNHIST table
|
IMPPRSRCITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPPRSRCITM table
|
IMSTRRCPOPR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPOPR table
|
IMSTRRCPPHS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPPHS table
|
IMTOBJLTITM-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTOBJLTITM table
|
INITRESITEM-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INITRESITEM table
|
INOTDPTDPMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTDPTDPMT table
|
INOTIFCAUSE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFCAUSE table
|
INOTIFTSKTS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSKTS table
|
IORDERBASIC-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDERBASIC table
|
IORGMAREACD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORGMAREACD table
|
IPAYFRCTREE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYFRCTREE table
|
IPLNGSCPHDR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VMP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPLNGSCPHDR table
|
IPMOBJLDATA-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMOBJLDATA table
|
IPOACCFINPO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOACCFINPO table
|
IPPKANBANCC-CREATIONDATE table field - Creation Date of Kanban Control Cycle
▼
Description: Creation Date of Kanban Control Cycle Field Name: CREATIONDATE Data Element: VDM_CRE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPKANBANCC table
|
IPRACCNOTIF-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCNOTIF table
|
IPRDPLNTMRP-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRDPLNTMRP table
|
IPRITMAPI01-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITMAPI01 table
|
IPRVDRCONTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTR table
|
IPSCONTRACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSCONTRACT table
|
IPURGCHGDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGCHGDOC table
|
IPURGQTAHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGQTAHDR table
|
IPURREQNITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITM table
|
IPVCONTRACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVCONTRACT table
|
IQLTYNOTIFC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNOTIFC table
|
IQLTYNTFCAU-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFCAU table
|
IQLTYNTFITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITM table
|
IREBUILDING-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREBUILDING table
|
IRECONTRACT-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACT table
|
IREPLDPOENH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREPLDPOENH table
|
IREPROPERTY-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREPROPERTY table
|
IRFMSITMSIT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSITMSIT table
|
IRFMSOPMHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSOPMHDR table
|
IRFMSOPMITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSOPMITM table
|
IRTGCOMPALC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGCOMPALC table
|
IRTGMTLASGN-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGMTLASGN table
|
ISASSETTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISASSETTP_D table
|
ISDEFECT_TP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP table
|
ISDSALESDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESDOC table
|
ISDSOIMPORT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSOIMPORT table
|
ISINVCHGDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINVCHGDOC table
|
ISPRODUCTWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD table
|
ISRVDOCNOTE-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVDOCNOTE table
|
ISUPPLCONFH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPPLCONFH table
|
ITEXTOBJECT-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITEXTOBJECT table
|
IVMSINVOICE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVMSINVOICE table
|
IWBSELEMENT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELEMENT table
|
IWLFCUSTSMT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCUSTSMT table
|
IWLFEXPNSMT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFEXPNSMT table
|
MAINTITEM_D-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITEM_D table
|
MEIRHEADERX-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEIRHEADERX table
|
MMQTNCOMP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMQTNCOMP_D table
|
MMRFQCOMP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMRFQCOMP_D table
|
PACTLSFOREP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTLSFOREP table
|
PAVCPORDITM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCPORDITM table
|
PAVCPURGDOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCPURGDOC table
|
PCABUSTRANS-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCABUSTRANS table
|
PCCACTTYPTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCACTTYPTP table
|
PCNASTCDALL-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNASTCDALL table
|
PDLVIADJDAT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDLVIADJDAT table
|
PEBORDPC3V2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDPC3V2 table
|
PEBPCERRLOG-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPCERRLOG table
|
PEMPLOYEEOP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEMPLOYEEOP table
|
PENTPRJCOST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENTPRJCOST table
|
PENTPROJACT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENTPROJACT table
|
PEQUISEARCH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEQUISEARCH table
|
PFILTERDSOS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFILTERDSOS table
|
PFLOCSEARCH-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFLOCSEARCH table
|
PGLACCTCURR-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGLACCTCURR table
|
PHEADERTEXT-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHEADERTEXT table
|
PMDOCSEARCH-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMDOCSEARCH table
|
PMEMORECORD-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: HZDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMEMORECORD table
|
PMLCPPOITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMLCPPOITEM table
|
PMMCPOIMONI-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCPOIMONI table
|
PMMRGQEVNT2-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMRGQEVNT2 table
|
PMPPRSRCITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMPPRSRCITM table
|
PPIRPOLMASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPIRPOLMASS table
|
PPOIDOCCHNG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOIDOCCHNG table
|
PPOITMCTAMT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITMCTAMT table
|
PPRDPLNTMRP-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRDPLNTMRP table
|
PPRIDOCCHNG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRIDOCCHNG table
|
PPURORDITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITEM table
|
PPURREQITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQITEM table
|
PPURREQNITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQNITM table
|
PRD_STORAGE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRD_STORAGE table
|
PRECONTRACT-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRECONTRACT table
|
PSALESDCMNT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSALESDCMNT table
|
PSLSCONTSTN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSCONTSTN table
|
PSLSQTANSTN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSQTANSTN table
|
PWRKPURREQN-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWRKPURREQN table
|
QINSPPLOP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPPLOP_D table
|
RPRODNORDTP-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPRODNORDTP table
|
UPDTRESITEM-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UPDTRESITEM table
|
VFCLMMMEKKO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLMMMEKKO table
|
VQAMR_ACTIV-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQAMR_ACTIV table
|
VQASE_ACTIV-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQASE_ACTIV table
|
VQASR_ACTIV-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQASR_ACTIV table
|
WB2_PO_DATA-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_PO_DATA table
|
WPOSN_CSGMT-CREATIONDATE table field - Entry Created On
▼
Description: Entry Created On Field Name: CREATIONDATE Data Element: POS_CSGMT_ERZDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WPOSN_CSGMT table
|
/PF1/CV_COND-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /PF1/DTE_BPE_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PF1/CV_COND table
|
/SCMB/S_EKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_EKPO table
|
ACLFNPRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACLFNPRODUCT table
|
ACNTRLPCTRVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACNTRLPCTRVH table
|
ACSTRANSDATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FINCS_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACSTRANSDATA table
|
AFIGLACCTLIT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIGLACCTLIT table
|
ASDBDREQITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDBDREQITEM table
|
AWBSELEMENT2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AWBSELEMENT2 table
|
BUPA_S_ORG_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUPA_S_ORG_D table
|
CACCSHORTAGE-CREATIONDATE table field - System Date
▼
Description: System Date Field Name: CREATIONDATE Data Element: SYDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACCSHORTAGE table
|
CACTLOGLPROD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CACTLOGLPROD table
|
CAPISINVOICE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAPISINVOICE table
|
CASCRTYDEP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CASCRTYDEP_D table
|
CBRVERIFYCTE-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBRVERIFYCTE table
|
CBSPALLITMVH-CREATIONDATE table field - Field of type DATS
▼
Description: Field of type DATS Field Name: CREATIONDATE Data Element: DATS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBSPALLITMVH table
|
CCADCREDITTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADCREDITTP table
|
CCAINVDOCREV-CREATIONDATE table field - Date Reversal Request Was Created
▼
Description: Date Reversal Request Was Created Field Name: CREATIONDATE Data Element: REVTRIG_CRDAT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOCREV table
|
CCHGIMPCTPLR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGIMPCTPLR table
|
CCORGMAREACD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCORGMAREACD table
|
CCRDSCRTREND-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDSCRTREND table
|
CDDFPOITEMVH-CREATIONDATE table field - Document Date
▼
Description: Document Date Field Name: CREATIONDATE Data Element: FAC_DDF_DOCUMENT_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFPOITEMVH table
|
CEBPSTRULETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBPSTRULETP table
|
CENTPRATTRIB-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENTPRATTRIB table
|
CEXPOSLSPROD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXPOSLSPROD table
|
CEXRQMTSDITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTSDITM table
|
CFABCHCHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFABCHCHGDOC table
|
CGRCCUSCNTRY-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCCUSCNTRY table
|
CGRCPAYMTERM-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCPAYMTERM table
|
CGRCSUPCNTRY-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCSUPCNTRY table
|
CHCTRITMMASS-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CHCTRITMMASS table
|
CHCTRMASSUPD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CHCTRMASSUPD table
|
CILMATLDOCVH-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CILMATLDOCVH table
|
CIM_D_HEADER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIM_D_HEADER table
|
CINQYWLF2370-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINQYWLF2370 table
|
CKEX2_F_POCR-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CKEX2_F_POCR table
|
CMDQLTYBPRES-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYBPRES table
|
CMFGCERTDESC-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGCERTDESC table
|
CMMRFQEVTTYP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMRFQEVTTYP table
|
CMPPRSRCGENR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPPRSRCGENR table
|
CNOTDSPDCRET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOTDSPDCRET table
|
CPAOBJASSGWD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAOBJASSGWD table
|
CPAOBJCONFWD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPAOBJCONFWD table
|
CPASQNCMNGWD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPASQNCMNGWD table
|
CPOACACCRSWL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOACACCRSWL table
|
CPPMGAGRMTTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAGRMTTP table
|
CPRDTVACCMON-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDTVACCMON table
|
CPROJGRAPHOV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJGRAPHOV table
|
CPUROUTAGRVH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUROUTAGRVH table
|
CQLTYKFANLYS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYKFANLYS table
|
CQLTYTSKPROC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKPROC table
|
CQTNITEMCOMP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQTNITEMCOMP table
|
CQTYINPROBPG-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQTYINPROBPG table
|
CRCPANALYSIS-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPANALYSIS table
|
CRCPHDRANLYS-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPHDRANLYS table
|
CRCPOVPACCBY-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPOVPACCBY table
|
CRCPOVPCHDBY-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPOVPCHDBY table
|
CREATECCTRVH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREATECCTRVH table
|
CRELDJRNLITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRELDJRNLITM table
|
CREPFINDRLAG-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREPFINDRLAG table
|
CRFDYODELIVI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFDYODELIVI table
|
CRFMSOPMFODH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMSOPMFODH table
|
CRFMSOPMFODI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMSOPMFODI table
|
CRMS4IUVCPRD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVCPRD table
|
CRMS4IUVICAH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVICAH table
|
CRMS4IUVICAP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVICAP table
|
CRMS4IUVICON-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVICON table
|
CRMS4IUVIPFP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVIPFP table
|
CRMS4IUVIPRD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVIPRD table
|
CRSMABAPPCKG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: RDIR_CDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSMABAPPCKG table
|
CRTORDERCOST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTORDERCOST table
|
CRUNOVHDSTAT-CREATIONDATE table field - Date Overhead document was created
▼
Description: Date Overhead document was created Field Name: CREATIONDATE Data Element: FCO_OVHD_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRUNOVHDSTAT table
|
CSCHEDAGRHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCHEDAGRHDR table
|
CSDDPLSLSDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDDPLSLSDOC table
|
CSDEXCINVPND-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDEXCINVPND table
|
CSDMCCUSTRET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCCUSTRET table
|
CSDMCDEMEREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCDEMEREQ table
|
CSDMCSLSQTAN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSQTAN table
|
CSDSALESVLMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSALESVLMQ table
|
CSDSLSCDITEM-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSCDITEM table
|
CSOFANALYZER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOFANALYZER table
|
CWFTSKCLSDBP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKCLSDBP table
|
CWFTSKCLSDMM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKCLSDMM table
|
CWLFPSDOCMON-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFPSDOCMON table
|
CWLFSETDOCOP-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSETDOCOP table
|
DELIVERY_ITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DELIVERY_ITM table
|
DETLARESITEM-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DETLARESITEM table
|
DFKKOPKC_GFN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERDAT_I_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKOPKC_GFN table
|
ESH_L_DEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_DEFECT table
|
ESH_L_PURCTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_PURCTR table
|
ESH_U_DEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_DEFECT table
|
ESH_U_PURCTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_PURCTR table
|
FAAD_MD_ROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAAD_MD_ROOT table
|
FACV_UH_AT_M-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FACV_UH_AT_M table
|
FAC_AUDASSET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_AUDASSET table
|
FAC_DZJECHGD-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZJECHGD table
|
FAC_DZMATHGD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZMATHGD table
|
FAC_DZVENDOR-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZVENDOR table
|
FCLMCONDITEM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLMCONDITEM table
|
FKK_VT_D_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_D_GFN table
|
FKK_VT_H_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_H_GFN table
|
FKK_VT_I_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_I_GFN table
|
FPS_CATEGORY-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FPS_CATEGORY table
|
FRM_EKPOVB_T-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FRM_EKPOVB_T table
|
IACCSHORTAGE-CREATIONDATE table field - System Date
▼
Description: System Date Field Name: CREATIONDATE Data Element: SYDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IACCSHORTAGE table
|
IAPINVACCMNT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAPINVACCMNT table
|
IAPISINVOICE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAPISINVOICE table
|
IAPPLOFFUNDB-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IAPPLOFFUNDB table
|
IBICAPARTNER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBICAPARTNER table
|
IBPARTNERGOV-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPARTNERGOV table
|
ICABPBUSLOCK-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABPBUSLOCK table
|
ICADCREDITTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADCREDITTP table
|
ICADOCCTNINV-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNINV table
|
ICADOCGLIPAY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERDAT_I_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCGLIPAY table
|
ICADOCHEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCHEADER table
|
ICAINTRUNHIS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CDATE_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINTRUNHIS table
|
ICARETURNLOT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICARETURNLOT table
|
ICATAXREPCLR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICATAXREPCLR table
|
ICATAXREPPST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICATAXREPPST table
|
ICFINRCIROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRCIROOT table
|
ICFINRPOROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRPOROOT table
|
ICFINRSIROOT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRSIROOT table
|
ICFINRSOITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRSOITEM table
|
ICFINRSOROOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFINRSOROOT table
|
ICLSPRTRIFEU-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLSPRTRIFEU table
|
ICLTASKDRAFT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICLTASKDRAFT table
|
ICMMROBECTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMROBECTTP table
|
ICNTRLRFQHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLRFQHDR table
|
ICRMERGESTAT-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRMERGESTAT table
|
ICTRPRTNRSWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRPRTNRSWD table
|
IDFSITEMDATA-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSITEMDATA table
|
IDFSMAINTBSC-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSMAINTBSC table
|
IEFDOCUMENTB-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDOCUMENTB table
|
IEMRKDFNDSVA-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEMRKDFNDSVA table
|
IENGPROJCUST-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IENGPROJCUST table
|
IEXRQMTSDITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSDITM table
|
IFGLIOPRANLS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFGLIOPRANLS table
|
IFIACTPLNJEI-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACTPLNJEI table
|
IFICCACTTYPD-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICCACTTYPD table
|
IFICOSTELMNT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFICOSTELMNT table
|
IFIGLACCOUNT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCOUNT table
|
IFIGLACCTBAL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTBAL table
|
IFIGLACCTLIR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLIR table
|
IFIGLACCTLIT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLIT table
|
IFMBDGECDOCC-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCC table
|
IFMBDGECDOCD-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCD table
|
IFMBDGECDOCE-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCE table
|
IFMBDGECDOCF-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCF table
|
IFMBDGECDOCH-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCH table
|
IFMBDGECDOCS-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGECDOCS table
|
IFMBDGTSTRUC-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTSTRUC table
|
IFUNDSCENTER-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDSCENTER table
|
IGMACDOCIANC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMACDOCIANC table
|
IGMBDCHGITMB-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMBDCHGITMB table
|
IGMSPCLASSCL-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMSPCLASSCL table
|
IGMSPCLASSQL-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMSPCLASSQL table
|
IICLNOTESINQ-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IICLNOTESINQ table
|
ILEOUTBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEOUTBDELIV table
|
ILOADIDBASIC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOADIDBASIC table
|
IMAINTCMPLNC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTCMPLNC table
|
IMAINTITEMTP-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEMTP table
|
IMAINTPLANTP-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTPLANTP table
|
IMATLSMPLDRW-CREATIONDATE table field - System Date When Material Sample Was Created
▼
Description: System Date When Material Sample Was Created Field Name: CREATIONDATE Data Element: QPRS_ANLDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATLSMPLDRW table
|
IMBTWTHTMPLT-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMBTWTHTMPLT table
|
IMCREPORTC_2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCREPORTC_2 table
|
IMCRPTENHANC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCRPTENHANC table
|
IMEASDOCDATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEASDOCDATA table
|
IMFGCERTWCTP-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGCERTWCTP table
|
IMMCPURORDER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMCPURORDER table
|
IMMPURORDENH-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDENH table
|
IMSTRRECPHDR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRECPHDR table
|
INFREC_HDR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFREC_HDR_D table
|
INOTDSPDCRET-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTDSPDCRET table
|
IP2POVERVIEW-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IP2POVERVIEW table
|
IPALLOCOBJTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPALLOCOBJTP table
|
IPOCONRULETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: POCONS_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOCONRULETP table
|
IPPBOOOPERCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPERCS table
|
IPPEQUIPRTIK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPEQUIPRTIK table
|
IPPMGAGRMTTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMGAGRMTTP table
|
IPPMISCPRTIK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMISCPRTIK table
|
IPPMSRGPRTIK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMSRGPRTIK table
|
IPRACCTASSGB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTASSGB table
|
IPRCGCNDNREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRCGCNDNREC table
|
IPRITEMAPI01-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMAPI01 table
|
IPRITEMBASIC-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMBASIC table
|
IPRODNRTGOPR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGOPR table
|
IPRODNVERSTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNVERSTP table
|
IPROJECTDATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJECTDATA table
|
IPROJOBJATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJOBJATTR table
|
IPRVDRCONTRH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRH table
|
IPRVDRCONTRI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRI table
|
IPURCHASECTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCHASECTR table
|
IPURCONTRAPI-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCONTRAPI table
|
IPURGQAAPI01-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGQAAPI01 table
|
IPURORDDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURORDDRAFT table
|
IPURORDERSIT-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURORDERSIT table
|
IPURREQNACCT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNACCT table
|
IQMNOTIFCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQMNOTIFCUBE table
|
IQNOTIFTSKVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFTSKVH table
|
IREBUSENTITY-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREBUSENTITY table
|
IRECONDITION-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONDITION table
|
IREINTOBJECT-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREINTOBJECT table
|
IRELDJRNLITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRELDJRNLITM table
|
IREPFINDRLAG-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREPFINDRLAG table
|
IRESETTLUNIT-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRESETTLUNIT table
|
IRFMMNGPOHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMNGPOHDR table
|
IRFMSALESDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSALESDOC table
|
IRFMSOISSTXT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSOISSTXT table
|
IRFMSOPMFODH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSOPMFODH table
|
IRFMSOPMFODI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSOPMFODI table
|
IRTGOPBSCESH-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGOPBSCESH table
|
IRTGSEQUENCE-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGSEQUENCE table
|
IRTLCHARCVAL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTLCHARCVAL table
|
ISAFTDELITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTDELITEM table
|
ISARUNRULETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SUP_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISARUNRULETP table
|
ISASSETTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISASSETTP_DR table
|
ISCSHCONCNTP-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCSHCONCNTP table
|
ISDBILDOCREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCREQ table
|
ISDEXCHDRDOC-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEXCHDRDOC table
|
ISDEXCISEDOC-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEXCISEDOC table
|
ISDEXCUTZDAT-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEXCUTZDAT table
|
ISDPREBILDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDPREBILDOC table
|
ISEASONBASIC-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONBASIC table
|
ISHPPLNDCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISHPPLNDCUBE table
|
ISLM_PSDRAFT-CREATIONDATE table field - Creation Date UTC time stamp
▼
Description: Creation Date UTC time stamp Field Name: CREATIONDATE Data Element: ISLM_DE_CREATIONDATE_UTC Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLM_PSDRAFT table
|
ISLM_TSKSCHD-CREATIONDATE table field - Creation Date UTC time stamp
▼
Description: Creation Date UTC time stamp Field Name: CREATIONDATE Data Element: ISLM_DE_CREATIONDATE_UTC Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLM_TSKSCHD table
|
ISTOCKHEADER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTOCKHEADER table
|
ISTORESTKADJ-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTORESTKADJ table
|
ISTSBRDEQUIP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTSBRDEQUIP table
|
ISUBCONBASIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUBCONBASIC table
|
ISWCSTRTDATA-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISWCSTRTDATA table
|
IVERSIONLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVERSIONLIST table
|
IWLFSUPLRBGD-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRBGD table
|
IWLFSUPLRSMT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRSMT table
|
MAINTNOTIF_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNOTIF_D table
|
MAINTNTFTO_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNTFTO_D table
|
MAINTORDER_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTORDER_D table
|
MMPUR_OA_SOS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OA_SOS table
|
MPCR_CAUSE_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPCR_CAUSE_D table
|
MPEV_CER_CAT-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEV_CER_CAT table
|
MPPRSRCITM_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPPRSRCITM_D table
|
OCIITM_PROPS-CREATIONDATE table field - Proposal Creation Date
▼
Description: Proposal Creation Date Field Name: CREATIONDATE Data Element: MMPUR_PROP_CREATED_AT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OCIITM_PROPS table
|
PACENTPRJCMT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACENTPRJCMT table
|
PACTENTPRJUN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTENTPRJUN table
|
PAPISINVOICE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPISINVOICE table
|
PAPLINEITEM6-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM6 table
|
PAPLINEITEM7-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPLINEITEM7 table
|
PARLINEITEM7-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM7 table
|
PARLINEITEM8-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARLINEITEM8 table
|
PBRNFTAXCALC-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBRNFTAXCALC table
|
PCAINTRUNHIS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CDATE_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCAINTRUNHIS table
|
PCNASTCDALL0-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNASTCDALL0 table
|
PDLVSHAPCALC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDLVSHAPCALC table
|
PEBPRCOGMCCG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPRCOGMCCG table
|
PEBPSTRLATMP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPSTRLATMP table
|
PENTPRJCMTMT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENTPRJCMTMT table
|
PENTPRJUNION-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENTPRJUNION table
|
PEQTSEGFLOCU-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEQTSEGFLOCU table
|
PFABCHCHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFABCHCHGDOC table
|
PFGLIOPRANLS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFGLIOPRANLS table
|
PFIACTPLNJEI-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIACTPLNJEI table
|
PFINRELOGHDR-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFINRELOGHDR table
|
PMBKWITHTMPL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT_BF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMBKWITHTMPL table
|
PMMCPOIMONI1-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCPOIMONI1 table
|
PMMPURREQITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURREQITM table
|
PMMRFQEVTTYP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMRFQEVTTYP table
|
PMMUNUSEDPC3-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMUNUSEDPC3 table
|
PNEMPLOYEEOP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNEMPLOYEEOP table
|
PNOTIFSEARCH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNOTIFSEARCH table
|
POBJLINKSRCH-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POBJLINKSRCH table
|
POEMPLOYEEOP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POEMPLOYEEOP table
|
PPPBOOOPERCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPBOOOPERCS table
|
PPRITEMRETDL-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRITEMRETDL table
|
PPRJBYACTCST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJBYACTCST table
|
PPRJBYPLNCST-CREATIONDATE table field - Posting Date
▼
Description: Posting Date Field Name: CREATIONDATE Data Element: FIS_BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJBYPLNCST table
|
PPRJBYPMOCST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJBYPMOCST table
|
PPROJBDGTITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJBDGTITM table
|
PRD_S_ROOT_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRD_S_ROOT_D table
|
PREQORDUNION-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQORDUNION table
|
PREQ_OPN_CNF-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQ_OPN_CNF table
|
PRHIACCTWI_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRHIACCTWI_D table
|
PRTMOLOGDATA-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTMOLOGDATA table
|
PRTORDERCOST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTORDERCOST table
|
PSDSLSODRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSODRITM table
|
PSLSORDFRQCY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSORDFRQCY table
|
PUEMPLOYEEOP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUEMPLOYEEOP table
|
PUKMGRCDCD_1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PUKMGRCDCD_1 table
|
PURCTR_HDR_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCTR_HDR_D table
|
PURGQTAHDR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURGQTAHDR_D table
|
PURREQNITM_D-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNITM_D table
|
PWBSELEMATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWBSELEMATTR table
|
PWUIOGRPHIER-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PWUIOGRPHIER table
|
QIPDPCHARC_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPDPCHARC_D table
|
QIPOPCHARC_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QIPOPCHARC_D table
|
RCNTRLRFQHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLRFQHDR table
|
REBPSTRULETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBPSTRULETP table
|
RECP_CLERK_C-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_CLERK_C table
|
SDPRCG_CNDNR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDPRCG_CNDNR table
|
VCH_HL_D_GRP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_HL_D_GRP table
|
VICARSDATE_D-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VICARSDATE_D table
|
VIIPOBJECT_D-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIIPOBJECT_D table
|
VQAPP_ACTIVE-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQAPP_ACTIVE table
|
V_DEF_BO2ACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_DEF_BO2ACT table
|
ABRNFDOCUMENT-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABRNFDOCUMENT table
|
ACSTRANSDATA2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FINCS_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACSTRANSDATA2 table
|
ADEBITMEMOREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADEBITMEMOREQ table
|
AFIGLACCINCOA-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIGLACCINCOA table
|
AINBDELIVERYH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINBDELIVERYH table
|
AINBDELIVERYI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINBDELIVERYI table
|
ASDBILLINGDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDBILLINGDOC table
|
ASEASONMASTER-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONMASTER table
|
ASUPQUOTATION-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASUPQUOTATION table
|
CBSPSLOITEMVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBSPSLOITEMVH table
|
CCABILLDOCREV-CREATIONDATE table field - Date Reversal Request Was Created
▼
Description: Date Reversal Request Was Created Field Name: CREATIONDATE Data Element: REVTRIG_CRDAT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABILLDOCREV table
|
CCADCFLLWUPTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADCFLLWUPTP table
|
CCADOCREVERSE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADOCREVERSE table
|
CCASCRTYDEPTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCASCRTYDEPTP table
|
CCBUSTRANSP2P-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCBUSTRANSP2P table
|
CCBUSTRANSREV-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCBUSTRANSREV table
|
CCHGRECNCLSVH-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECNCLSVH table
|
CCHGRECREFINP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFINP table
|
CCHGRECREFLBL-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFLBL table
|
CCHGRECREFMRC-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFMRC table
|
CCRDMEMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDMEMATTRIB table
|
CCSBSPLRPT90Q-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSBSPLRPT90Q table
|
CCWFSETTLMTRW-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCWFSETTLMTRW table
|
CDBTMEMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDBTMEMATTRIB table
|
CDDFANCHDOCVH-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFANCHDOCVH table
|
CDDFPURGDOCVH-CREATIONDATE table field - Document Date
▼
Description: Document Date Field Name: CREATIONDATE Data Element: FAC_DDF_DOCUMENT_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFPURGDOCVH table
|
CDDFPURREQNAT-CREATIONDATE table field - Document Date in Document
▼
Description: Document Date in Document Field Name: CREATIONDATE Data Element: BLDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFPURREQNAT table
|
CDDFPURREQNVH-CREATIONDATE table field - Document Date
▼
Description: Document Date Field Name: CREATIONDATE Data Element: FAC_DDF_DOCUMENT_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFPURREQNVH table
|
CDPLSLSDOCGRP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDPLSLSDOCGRP table
|
CEBPOSTGERROR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBPOSTGERROR table
|
CENGRECORDHDR-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: /PLMB/CC_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: CC_DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENGRECORDHDR table
|
CENGSNPREFDOC-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENGSNPREFDOC table
|
CEXISTPRCPROD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXISTPRCPROD table
|
CEXRQMTACCITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTACCITM table
|
CEXRQMTSTOITM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTSTOITM table
|
CFIXASSETMNTN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIXASSETMNTN table
|
CGBPRMAINTHDR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGBPRMAINTHDR table
|
CGHOPNLINKLOG-CREATIONDATE table field - Creation Date of Change Document
▼
Description: Creation Date of Change Document Field Name: CREATIONDATE Data Element: GHO_NM_CD_CRT_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGHOPNLINKLOG table
|
CGRCQMDISPROD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCQMDISPROD table
|
CINSPMETHODOP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPMETHODOP table
|
CMAINTITEMDEX-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTITEMDEX table
|
CMAINTNOTIFTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTNOTIFTP table
|
CMAINTNOTIFVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTNOTIFVH table
|
CMAINTPLANDEX-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMAINTPLANDEX table
|
CMMPOIDOCCHNG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPOIDOCCHNG table
|
CMMPRIDOCCHNG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRIDOCCHNG table
|
CMPESFODEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPESFODEFECT table
|
CMPLANCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPLANCHNHIST table
|
CNLSAFTHEADER-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNLSAFTHEADER table
|
CNTRLRFQHDR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLRFQHDR_D table
|
CPLBILLINGDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPLBILLINGDOC table
|
CPRDSTORLOCWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRDSTORLOCWD table
|
CPREBILLWFINX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPREBILLWFINX table
|
CPROJFINSMMRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPROJFINSMMRY table
|
CPURCTRPRTNRS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURCTRPRTNRS table
|
CQLTYNOTIFFDP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNOTIFFDP table
|
CQNOTIFTSKFDP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQNOTIFTSKFDP table
|
CRACHGDOCITEM-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FIS_AUFAEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRACHGDOCITEM table
|
CRCPOVPCRTDBY-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPOVPCRTDBY table
|
CREJCTDSLSORD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREJCTDSLSORD table
|
CRFMMASADOITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOITM table
|
CRFMMASADOSDH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOSDH table
|
CRFMMNGPOTRAC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMNGPOTRAC table
|
CRFMPRVSNLITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMPRVSNLITM table
|
CRFMSOPMGNITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMSOPMGNITM table
|
CRMS4IUVIPFPS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVIPFPS table
|
CRMS4VPRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4VPRODUCT table
|
CRWFTSKOPENBP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRWFTSKOPENBP table
|
CRWFTSKOPENMM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRWFTSKOPENMM table
|
CSBSCRPATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSBSCRPATTRIB table
|
CSDCRWRKFLWIN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCRWRKFLWIN table
|
CSDDMRWFINBOX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDDMRWFINBOX table
|
CSDMCSLSCONTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSCONTR table
|
CSKB_DRAFT_20-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSKB_DRAFT_20 table
|
CSOWOCWLF2305-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOWOCWLF2305 table
|
CSRVCNFATTRIB-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRMS4_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCNFATTRIB table
|
CSRVMPLANSITN-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVMPLANSITN table
|
CUKMGRCDCDREL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CUKMGRCDCDREL table
|
CURREQNATTRIB-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CURREQNATTRIB table
|
CWFTSKCLSDFIN-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKCLSDFIN table
|
CWLFEXPNSMTOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFEXPNSMTOF table
|
DELIVERY_HEAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DELIVERY_HEAD table
|
DFKKINV_CFC_D-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKKINV_CFC_D table
|
DFKK_VT_D_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_D_GFN table
|
DFKK_VT_H_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_H_GFN table
|
DFKK_VT_I_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_I_GFN table
|
DRAFT_QTA_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRAFT_QTA_HDR table
|
ESH_L_BDGTPER-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_BDGTPER table
|
ESH_L_MATLDOC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_MATLDOC table
|
ESH_L_QLTYACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_QLTYACT table
|
ESH_L_SPLRQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_SPLRQTN table
|
ESH_U_BDGTPER-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_BDGTPER table
|
ESH_U_MATLDOC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_MATLDOC table
|
ESH_U_QLTYACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_QLTYACT table
|
ESH_U_SPLRQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_SPLRQTN table
|
FACZ3BLHDRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FACZ3BLHDRITM table
|
FACZ3SDHDRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FACZ3SDHDRITM table
|
FAC_DZASSCHGD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZASSCHGD table
|
FAC_DZCHOFACC-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZCHOFACC table
|
FAC_DZGLDCHGD-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZGLDCHGD table
|
FAC_DZMATHGDB-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZMATHGDB table
|
FAC_DZSALEITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZSALEITM table
|
FCLMGLACCOUNT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLMGLACCOUNT table
|
FDP_QM_DEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT table
|
FKKBIX_CA_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_CA_GFN table
|
FKKINV_CA_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_CA_GFN table
|
FKKINV_KO_GFN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_KO_GFN table
|
FKK_VT_ST_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_ST_GFN table
|
FKK_VT_TR_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_TR_GFN table
|
IALLOCTBLITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCTBLITEM table
|
IBANKCONDITTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKCONDITTP table
|
IBDGTDOCBASIC-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTDOCBASIC table
|
IBDGTDOCUMENT-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTDOCUMENT table
|
IBNKEXTSTSMSG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBNKEXTSTSMSG table
|
IBRNFDOCUMENT-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBRNFDOCUMENT table
|
IBUDGETPERIOD-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUDGETPERIOD table
|
ICABILLDOCREV-CREATIONDATE table field - Date Reversal Request Was Created
▼
Description: Date Reversal Request Was Created Field Name: CREATIONDATE Data Element: REVTRIG_CRDAT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABILLDOCREV table
|
ICABIPRPRVT_I-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABIPRPRVT_I table
|
ICADCFLLWUPTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADCFLLWUPTP table
|
ICADOCCTNINVI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNINVI table
|
ICADOCCTNITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNITEM table
|
ICADOCCTNPAYI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNPAYI table
|
ICADOCCTNPAYT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNPAYT table
|
ICAMDDISTROBJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDDISTROBJ table
|
ICAPAYMENTLOT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPAYMENTLOT table
|
ICASCRTYDEPTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASCRTYDEPTP table
|
ICASDOCHEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASDOCHEADER table
|
ICASECDEPPROC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASECDEPPROC table
|
ICNMATSTKVALN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNMATSTKVALN table
|
ICNTRTPRICHST-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRTPRICHST table
|
ICTRACCHEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRACCHEADER table
|
ICVDIRBOMLINK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDIRBOMLINK table
|
IDDFACCTMAINT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDDFACCTMAINT table
|
IDDFANCHDOCVH-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDDFANCHDOCVH table
|
IDDFPURREQNAT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDDFPURREQNAT table
|
IDFSORGMCDHDR-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSORGMCDHDR table
|
IDMECTREEDRFT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDMECTREEDRFT table
|
IEXRQMTACCITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTACCITM table
|
IEXRQMTSTOITM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSTOITM table
|
IFGLISOPRCUBE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFGLISOPRCUBE table
|
IFIACCDOCJRNL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACCDOCJRNL table
|
IFIBANKMASTER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT_BF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKMASTER table
|
IFIGLACCINCOA-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCINCOA table
|
IFIGLICMPCUBE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLICMPCUBE table
|
IFIGLLITMCUBE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLLITMCUBE table
|
IFIJELITBROWS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJELITBROWS table
|
IFIPROFANADOC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIPROFANADOC table
|
IFLGHTFLSTRUC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLGHTFLSTRUC table
|
IFMFUNDEDPROG-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNDEDPROG table
|
IFRAUDVERSION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFRAUDVERSION table
|
IFUNDSCENTERB-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNDSCENTERB table
|
IGHOPNLINKLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGHOPNLINKLOG table
|
IGOODSMVMTDOC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGOODSMVMTDOC table
|
IICLPENDTASKS-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IICLPENDTASKS table
|
IINSPPLMASSGV-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLMASSGV table
|
IINSPSUBSETTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETTP table
|
IINSUBCONLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSUBCONLIST table
|
IMAINTNTFTETP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNTFTETP table
|
IMAINTOBJLINK-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTOBJLINK table
|
IMAINTORDERHS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDERHS table
|
IMAINTORDERTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDERTP table
|
IMATDOCHEADER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCHEADER table
|
IMATOVRDSITPD-CREATIONDATE table field - Purchase Order Posting Date
▼
Description: Purchase Order Posting Date Field Name: CREATIONDATE Data Element: MMIM_PO_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATOVRDSITPD table
|
IMFGDEFECTSIT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGDEFECTSIT table
|
IMFGICHISTROY-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGICHISTROY table
|
IMFGORDDEFREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDDEFREC table
|
IMMPOSCHEDENH-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPOSCHEDENH table
|
IMMPUROACCASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPUROACCASS table
|
IMMPURORDMAIL-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDMAIL table
|
IMOEMAILPARAM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMOEMAILPARAM table
|
IMPPRSRCITMWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPPRSRCITMWD table
|
IMSTRRCPOPBOM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPOPBOM table
|
INOTIFFLSTRUC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFFLSTRUC table
|
INOTIFICATION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFICATION table
|
IORDERFLSTRUC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDERFLSTRUC table
|
IPDACCTASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDACCTASSGMT table
|
IPDSCHLINEEXT-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDSCHLINEEXT table
|
IPMORDOPERDEX-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPMORDOPERDEX table
|
IPODRAFTFORPR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPODRAFTFORPR table
|
IPPBOOOPPRTCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPPRTCS table
|
IPPFACTORYCAL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPFACTORYCAL table
|
IPRACCTASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTASSGMT table
|
IPRACCTWRKITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTWRKITM table
|
IPRDPLNTMRPTP-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRDPLNTMRPTP table
|
IPRITMOPENCNF-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITMOPENCNF table
|
IPRMTHBPRITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITEM table
|
IPROCESSROUTE-CREATIONDATE table field - Date Process Route Created
▼
Description: Date Process Route Created Field Name: CREATIONDATE Data Element: SRMWFCRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCESSROUTE table
|
IPRODNVERSLCH-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNVERSLCH table
|
IPROJBDGTITEM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJBDGTITEM table
|
IPROJBYINTKEY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJBYINTKEY table
|
IPROJFINSMMRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJFINSMMRY table
|
IPROJNTWKVERS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJNTWKVERS table
|
IPRVDRCONTRTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRTR table
|
IPTDIGITALSIG-CREATIONDATE table field - Signature PT: Creation Date
▼
Description: Signature PT: Creation Date Field Name: CREATIONDATE Data Element: SIPT_CREADATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTDIGITALSIG table
|
IPTSAFTDELHDR-CREATIONDATE table field - Signature PT: Creation Date
▼
Description: Signature PT: Creation Date Field Name: CREATIONDATE Data Element: SIPT_CREADATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTSAFTDELHDR table
|
IPTSAFTDELOTC-CREATIONDATE table field - Signature PT: Creation Date
▼
Description: Signature PT: Creation Date Field Name: CREATIONDATE Data Element: SIPT_CREADATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTSAFTDELOTC table
|
IPUBSECBRFMSG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSG table
|
IPURGINFORECD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGINFORECD table
|
IPURGQTAHDRTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGQTAHDRTP table
|
IPVCONTRACTVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVCONTRACTVH table
|
IQLTYINPROCMT-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINPROCMT table
|
IQLTYNTFITMTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITMTP table
|
IRACHGDOCITEM-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FIS_AUFAEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRACHGDOCITEM table
|
IREALTPTDFIND-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREALTPTDFIND table
|
IREOBJADDRESS-CREATIONDATE table field - Date of Initial Entry
▼
Description: Date of Initial Entry Field Name: CREATIONDATE Data Element: REBDDERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREOBJADDRESS table
|
IREREMINDDATE-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREMINDDATE table
|
IRERENTOBJECT-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRERENTOBJECT table
|
IRESETTLMTVAR-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRESETTLMTVAR table
|
IRFMMASADOBSC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADOBSC table
|
IRFMMASADOHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADOHDR table
|
IRFMMASADOITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADOITM table
|
IRFMMNGPOTRAC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMNGPOTRAC table
|
IRFMPRVSNLBSC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLBSC table
|
IRFMPRVSNLDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLDOC table
|
IRFMPRVSNLITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLITM table
|
IRFMSOPMGNITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMSOPMGNITM table
|
IRFQCOMPARETP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFQCOMPARETP table
|
IRTGCOMPALLOC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGCOMPALLOC table
|
IRTLPROMNITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTLPROMNITEM table
|
ISAFTBILLITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTBILLITEM table
|
ISAFTINVLISTH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTINVLISTH table
|
ISAFTSMHEADER-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTSMHEADER table
|
ISAMPLEDETAIL-CREATIONDATE table field - System Date When Material Sample Was Created
▼
Description: System Date When Material Sample Was Created Field Name: CREATIONDATE Data Element: QPRS_ANLDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAMPLEDETAIL table
|
ISDBILLINGDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLINGDOC table
|
ISDCRENHANCED-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCRENHANCED table
|
ISDCUSTRETURN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETURN table
|
ISDEFECT_TP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_D table
|
ISDSALESORDER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESORDER table
|
ISDSLESCONTST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLESCONTST table
|
ISDSLESQTANST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLESQTANST table
|
ISDSLSCONTRIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSCONTRIC table
|
ISDSLSINQYITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSINQYITM table
|
ISDSLSQTANCRC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTANCRC table
|
ISDSLSQTANITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTANITM table
|
ISDSOWTHOCHRG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSOWTHOCHRG table
|
ISEASONMASTER-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONMASTER table
|
ISGRANTCORETP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRANTCORETP table
|
ISLM_ACTIVHIS-CREATIONDATE table field - Creation Date UTC time stamp
▼
Description: Creation Date UTC time stamp Field Name: CREATIONDATE Data Element: ISLM_DE_CREATIONDATE_UTC Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLM_ACTIVHIS table
|
ISPRODNVERSTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODNVERSTP table
|
ISPRODUCTWD_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD_D table
|
ISRVMPLANSITN-CREATIONDATE table field - Application log: date
▼
Description: Application log: date Field Name: CREATIONDATE Data Element: BALDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVMPLANSITN table
|
ISSWCSTRTDATA-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA table
|
ISULOSSHEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISULOSSHEADER table
|
ISUPLPARTFUNC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLPARTFUNC table
|
ISUPUSRDEFCRT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: MMPUR_ANA_CREATEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_CREATEDON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPUSRDEFCRT table
|
ITMBPBYINTKEY-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITMBPBYINTKEY table
|
ITRANSPORDERE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPORDERE table
|
ITRGTUSERDATA-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRGTUSERDATA table
|
IWBSELMNTDATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELMNTDATA table
|
IWLFCUSTSTLST-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCUSTSTLST table
|
IWLFSMTDOCITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDOCITM table
|
IWLFSMTDOCLST-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDOCLST table
|
IWLFSMTMGTDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTMGTDOC table
|
IWLFSTDOCPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSTDOCPART table
|
IWLFSUPBDPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPBDPART table
|
MMPUR_S_PO_GR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_GR table
|
MPCR_REASON_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPCR_REASON_D table
|
MPEGMETPDRAFT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEGMETPDRAFT table
|
MPEPRODNVERSD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEPRODNVERSD table
|
MPEV_CER_E_WC-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEV_CER_E_WC table
|
MPE_QUAL_E_WC-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPE_QUAL_E_WC table
|
NCHGRECREFPPO-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRECREFPPO table
|
NCHGRECREFPPU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRECREFPPU table
|
NCHGRECREFROU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRECREFROU table
|
PACENTPRJCOST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACENTPRJCOST table
|
PACTENTPRJPLN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTENTPRJPLN table
|
PBRSPEDNFSTCT-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBRSPEDNFSTCT table
|
PCCTRPRCHISTV-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTRPRCHISTV table
|
PCLSPREUKDATE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCLSPREUKDATE table
|
PCONFPRPLBASE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONFPRPLBASE table
|
PCRDMEMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCRDMEMATTRIB table
|
PCRDTLMTCHNG1-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCRDTLMTCHNG1 table
|
PCRDTLMTCHNG2-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCRDTLMTCHNG2 table
|
PCVDIRBOMLINK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCVDIRBOMLINK table
|
PDBTMEMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDBTMEMATTRIB table
|
PEBPRCOGMCCG1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPRCOGMCCG1 table
|
PEBPRCOGMCCG2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPRCOGMCCG2 table
|
PEBPRCOGMCCG3-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPRCOGMCCG3 table
|
PEBPRCOGMCCG4-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPRCOGMCCG4 table
|
PEBPRCOGMCCG5-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBPRCOGMCCG5 table
|
PEBWIPFULLORD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBWIPFULLORD table
|
PEBWIPORDCST2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBWIPORDCST2 table
|
PEBWIPORDCST3-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBWIPORDCST3 table
|
PEBWIPORDCST4-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBWIPORDCST4 table
|
PFIGLACCTINCC-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTINCC table
|
PFIJELITBROWS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIJELITBROWS table
|
PFIPCTRCHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPCTRCHGDOC table
|
PICSAMHISTORY-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PICSAMHISTORY table
|
PINSPRSLTSTAT-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PINSPRSLTSTAT table
|
PMATPLANTSLOC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATPLANTSLOC table
|
PMD_S_PRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PRODUCT table
|
PMFGICHISTORY-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGICHISTORY table
|
PMFGORDDEFREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGORDDEFREC table
|
PMLCPPOITEMCC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMLCPPOITEMCC table
|
PMMCTRLPOITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCTRLPOITEM table
|
PMMPOSCHEDENH-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEDENH table
|
PMMPURCONEXP1-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURCONEXP1 table
|
PMMRELDOCVAL4-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMRELDOCVAL4 table
|
PPMGAG_T_PP_D-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPMGAG_T_PP_D table
|
PPORDITEMCALC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPORDITEMCALC table
|
PPRCSLINITMUN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCSLINITMUN table
|
PPREDDTEINTMD-CREATIONDATE table field - Posting Date
▼
Description: Posting Date Field Name: CREATIONDATE Data Element: FIS_BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPREDDTEINTMD table
|
PPRJBYPMIOCST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJBYPMIOCST table
|
PPRODNVERSION-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRODNVERSION table
|
PPROJNTWKATTR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJNTWKATTR table
|
PRACHGDOCITEM-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACHGDOCITEM table
|
PREJCTDSLSORD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREJCTDSLSORD table
|
PREQ_OPN_CNFM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQ_OPN_CNFM table
|
PREVNACCTITEM-CREATIONDATE table field - Revenue Accounting Item Creation Date
▼
Description: Revenue Accounting Item Creation Date Field Name: CREATIONDATE Data Element: FARR_CDS_RAI_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREVNACCTITEM table
|
PROD_PLNT_MRP-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_PLNT_MRP table
|
PRTWIPHISTORY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPHISTORY table
|
PRTWIPPRODORD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPPRODORD table
|
PSAFTCANCSETD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSAFTCANCSETD table
|
PSDSLSORDCONF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSORDCONF table
|
PSIMFORSEARCH-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIMFORSEARCH table
|
PSIQTYVARPRED-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIQTYVARPRED table
|
PSLSDOCITMBSC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITMBSC table
|
PSRVCCONTRFIN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCCONTRFIN table
|
PSRVCNFATTRIB-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRMS4_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCNFATTRIB table
|
PSRVINTORDCUB-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVINTORDCUB table
|
PURCHASECTR_D-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCHASECTR_D table
|
PURCTRPRTNR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCTRPRTNR_D table
|
PURREQNACCT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNACCT_D table
|
PURREQNATTRIB-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNATTRIB table
|
REBTMPPSTRULE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBTMPPSTRULE table
|
RESETCLEARING-CREATIONDATE table field - Accounting Document Entry Date
▼
Description: Accounting Document Entry Date Field Name: CREATIONDATE Data Element: FARP_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESETCLEARING table
|
SKA1_DRAFT_20-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SKA1_DRAFT_20 table
|
SKB1_DRAFT_20-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SKB1_DRAFT_20 table
|
VCH_SIM_DRAFT-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_SIM_DRAFT table
|
V_QTSK_DR2ACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_QTSK_DR2ACT table
|
/DMBE/IBUSPART-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/IBUSPART table
|
/SAPSLL/EKPO_S-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPSLL/EKPO_S table
|
ABPPAYBT_DRAFT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABPPAYBT_DRAFT table
|
ACAPRVDRCONTRH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACAPRVDRCONTRH table
|
ACAPRVDRCONTRI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACAPRVDRCONTRI table
|
ACLFNPRODCLHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACLFNPRODCLHDR table
|
ACRDTBLKDDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACRDTBLKDDELIV table
|
ACREDITMEMOREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACREDITMEMOREQ table
|
AET_MATLDOCITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AET_MATLDOCITM table
|
AINBDELIVERYH1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINBDELIVERYH1 table
|
AINBDELIVERYI1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINBDELIVERYI1 table
|
AINSPSAMPLERES-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPSAMPLERES table
|
AOUTBDELIVERYH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AOUTBDELIVERYH table
|
AOUTBDELIVERYI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AOUTBDELIVERYI table
|
APURCHASEORDER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURCHASEORDER table
|
ARETSDELIVERYH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARETSDELIVERYH table
|
ARETSDELIVERYI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARETSDELIVERYI table
|
ASALESCONTRACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASALESCONTRACT table
|
ASDSCHEDGAGRMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDSCHEDGAGRMT table
|
ASDSUBSEQBDSBI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDSUBSEQBDSBI table
|
ASUPLRPARTFUNC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASUPLRPARTFUNC table
|
BUSTRANPAYTEXP-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSTRANPAYTEXP table
|
CADISPCREDIT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CADISPCREDIT_D table
|
CADISPFLLWUP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CADISPFLLWUP_D table
|
CANALACCRPOSTG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CANALACCRPOSTG table
|
CBANKACCOUNTTP-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBANKACCOUNTTP table
|
CBDOCITEMF0797-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDOCITEMF0797 table
|
CBEHQANALYTICS-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: SSTR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBEHQANALYTICS table
|
CCABUSTRANCORR-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANCORR table
|
CCAINVDOCH_COH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVDOCH_COH table
|
CCAINVOVWVTKEY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAINVOVWVTKEY table
|
CCAPAYMENTLIST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAPAYMENTLIST table
|
CCARECONCILKEY-CREATIONDATE table field - Date of entry (CPU date)
▼
Description: Date of entry (CPU date) Field Name: CREATIONDATE Data Element: CPUDT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCARECONCILKEY table
|
CCARETPAYDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCARETPAYDOCVH table
|
CCBUSTRANSRETN-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCBUSTRANSRETN table
|
CCCATYPECHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCCATYPECHGDOC table
|
CCCRSALESDOCVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCCRSALESDOCVH table
|
CCFINRPOHEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCFINRPOHEADER table
|
CCHGRECDENGSNP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECDENGSNP table
|
CCHGRECREFEBOM-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFEBOM table
|
CCHGRECREFRCP1-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFRCP1 table
|
CCLSPRTRIFNOEU-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCLSPRTRIFNOEU table
|
CCNTRLQTNFACET-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLQTNFACET table
|
CCNTRLQTNITMTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLQTNITMTP table
|
CCNTRLRFQHDRTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLRFQHDRTP table
|
CCNTXISUPPLIER-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTXISUPPLIER table
|
CCPCVERCOMPHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCPCVERCOMPHDR table
|
CCTRVERSHIST_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRVERSHIST_D table
|
CCWFSETTLMTREL-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCWFSETTLMTREL table
|
CDDFSALESDOCVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFSALESDOCVH table
|
CDEFECTMNGQNVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTMNGQNVH table
|
CEHSRASFTSKLST-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEHSRASFTSKLST table
|
CENGSNPREFEBOM-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENGSNPREFEBOM table
|
CENGSNPREFVDOC-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: MPE_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CENGSNPREFVDOC table
|
CEXRQMTCONTITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXRQMTCONTITM table
|
CFIGENLDGRACCT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIGENLDGRACCT table
|
CFIN_AVCI_DOCE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVCI_DOCE table
|
CFIN_AVSI_DOCE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVSI_DOCE table
|
CFIN_AVSO_DOCE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVSO_DOCE table
|
CGMGRANTCORETP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGMGRANTCORETP table
|
CGRCALTVPYESUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCALTVPYESUP table
|
CICLCLMTASKINQ-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CICLCLMTASKINQ table
|
CINSPPLDPCHARC-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLDPCHARC table
|
CINSPRSLTHSTRY-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPRSLTHSTRY table
|
CINSPRSLTVALUE-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPRSLTVALUE table
|
CINSPSUBRESVAL-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSUBRESVAL table
|
CJVAOUTREQITEM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CJVAOUTREQITEM table
|
CMATOVERDUESIT-CREATIONDATE table field - Purchase Order Posting Date
▼
Description: Purchase Order Posting Date Field Name: CREATIONDATE Data Element: MMIM_PO_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATOVERDUESIT table
|
CMMPURCONTRDEX-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURCONTRDEX table
|
CMNOTIFCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMNOTIFCHNHIST table
|
CMORDERCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMORDERCHNHIST table
|
CNTRCTACNTPRTN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRCTACNTPRTN table
|
COBJPGMAINTORD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COBJPGMAINTORD table
|
COUTBDELIVLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COUTBDELIVLIST table
|
CPCCOCDCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCCOCDCHNGLOG table
|
CPFMGDSMVTDDEX-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPFMGDSMVTDDEX table
|
CPOALTSUPLRSIT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOALTSUPLRSIT table
|
CPPMGAGRMTMNTR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAGRMTMNTR table
|
CPRACCTASSMTWI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRACCTASSMTWI table
|
CPRSOLPROCQTSK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRSOLPROCQTSK table
|
CPTSAFTDELHDRC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 19(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPTSAFTDELHDRC table
|
CPTSAFTDELHDRQ-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 19(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPTSAFTDELHDRQ table
|
CPURINFRECMASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURINFRECMASS table
|
CQLTYINPROCMNG-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYINPROCMNG table
|
CQLTYNTFITMFDP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNTFITMFDP table
|
CRCPOVPVLDSOON-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPOVPVLDSOON table
|
CREJCTDSLSQUOT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREJCTDSLSQUOT table
|
CRETSLSORDITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRETSLSORDITEM table
|
CRMS4IUVPCONBP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVPCONBP table
|
CRMS4S_EQUI_IL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUI_IL table
|
CRMS4S_PRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_PRODUCT table
|
CRTLPROMNOBJPG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTLPROMNOBJPG table
|
CRTWIPLDAYHIST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTWIPLDAYHIST table
|
CRWFTSKOPENFIN-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRWFTSKOPENFIN table
|
CSDCUSTRETITMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCUSTRETITMQ table
|
CSDMCSLSORDITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSORDITM table
|
CSDSDOCITMPEDX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCITMPEDX table
|
CSDSLSDOCITMDX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSDOCITMDX table
|
CSLSOWCHATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSOWCHATTRIB table
|
CSRVCONTINTQRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCONTINTQRY table
|
CSRVDOCHDRNOTE-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVDOCHDRNOTE table
|
CSRVDOCITMNOTE-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVDOCITMNOTE table
|
CSTTLMNTACTWBS-CREATIONDATE table field - Last Run or Reversed On
▼
Description: Last Run or Reversed On Field Name: CREATIONDATE Data Element: FCO_SETTLMT_LAST_SETTLED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTTLMNTACTWBS table
|
CWLFSMTDOCFORM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSMTDOCFORM table
|
CWLFSUPLRBGDOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSUPLRBGDOF table
|
CWLFSUPLRSMTOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSUPLRSMTOF table
|
CWZREMNGSETDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWZREMNGSETDOC table
|
DFKK_VT_ST_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_ST_GFN table
|
DFKK_VT_TR_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_VT_TR_GFN table
|
ESH_L_CNTRLQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CNTRLQTN table
|
ESH_L_INBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INBDELIV table
|
ESH_L_PURORDER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_PURORDER table
|
ESH_L_QLTYITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_QLTYITEM table
|
ESH_L_QLTYTASK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_QLTYTASK table
|
ESH_U_CNTRLQTN-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CNTRLQTN table
|
ESH_U_CORRSPON-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CORRSPON table
|
ESH_U_INBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INBDELIV table
|
ESH_U_PURORDER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_PURORDER table
|
ESH_U_QLTYITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_QLTYITEM table
|
ESH_U_QLTYTASK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_QLTYTASK table
|
EXPD_EKPO_LINE-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_EKPO_LINE table
|
EXP_INPUT_DATA-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXP_INPUT_DATA table
|
FAC_AUDCUSCHGB-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_AUDCUSCHGB table
|
FAC_AUDCUSCHGP-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_AUDCUSCHGP table
|
FAC_AUDCUSTCHG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_AUDCUSTCHG table
|
FAC_AUDPROJECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_AUDPROJECT table
|
FAC_AUDWBSELMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_AUDWBSELMT table
|
FAC_DZASSCHGDB-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZASSCHGDB table
|
FAC_DZCUSTOMER-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZCUSTOMER table
|
FAC_DZGLDCHGDB-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZGLDCHGDB table
|
FAP_RSIV_TMPLR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FARP_RECURR_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAP_RSIV_TMPLR table
|
FARV_PYADV_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FARV_PYADV_HDR table
|
FCOS_FILTERBAR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCOS_FILTERBAR table
|
FCO_OVHD_STADR-CREATIONDATE table field - Date Overhead document was created
▼
Description: Date Overhead document was created Field Name: CREATIONDATE Data Element: FCO_OVHD_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_OVHD_STADR table
|
FISCDSTRKDOC04-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSTRKDOC04 table
|
FISCDSTRKDOC05-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSTRKDOC05 table
|
FISCDSTRKDOC07-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISCDSTRKDOC07 table
|
FJEPGOODSMOVHD-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FJEPGOODSMOVHD table
|
FKKINV_SEC_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_SEC_GFN table
|
FMBS_FMADDRESS-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMBS_FMADDRESS table
|
FMBUDGET_DOCHD-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMBUDGET_DOCHD table
|
FPS_DICTIONARY-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FPS_DICTIONARY table
|
IALIGNSOHDRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNSOHDRITM table
|
IBRNFDOCADMINC-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBRNFDOCADMINC table
|
IBUDGETPERIODB-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUDGETPERIODB table
|
ICABUSLOCKHIST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICABUSLOCKHIST table
|
ICACLARIFDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACLARIFDOCVH table
|
ICADISPPAYMENT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADISPPAYMENT table
|
ICADOCCTNPAYTH-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNPAYTH table
|
ICAPRVDRCONTRH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRH table
|
ICAPRVDRCONTRI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRI table
|
ICARECONCILKEY-CREATIONDATE table field - Date of entry (CPU date)
▼
Description: Date of entry (CPU date) Field Name: CREATIONDATE Data Element: CPUDT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICARECONCILKEY table
|
ICARETURNDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICARETURNDOCVH table
|
ICAWORKLISTHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAWORKLISTHDR table
|
ICHFIEXCSTCA_D-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHFIEXCSTCA_D table
|
ICJRNLENTRITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICJRNLENTRITEM table
|
ICMMFIXSPREADS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMFIXSPREADS table
|
ICNTRLRFQHDRTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLRFQHDRTP table
|
ICONFSLSORDCAQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICONFSLSORDCAQ table
|
ICRDTBLKDDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTBLKDDELIV table
|
ICSJRNLENTRITP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSJRNLENTRITP table
|
ICTRACCPARTNER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRACCPARTNER table
|
IDEFAULTABLEBP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFAULTABLEBP table
|
IDFSMAINTNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSMAINTNOTIF table
|
IDFSMAINTORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSMAINTORDER table
|
IDFSNOTIFSTRUC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSNOTIFSTRUC table
|
IDFSORDERSTRUC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDFSORDERSTRUC table
|
IENGRECORDATTR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IENGRECORDATTR table
|
IET_MATLDOCITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IET_MATLDOCITM table
|
IEXRQMTCONTITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTCONTITM table
|
IFIBANKACCOUNT-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKACCOUNT table
|
IFIBANKACC_VH1-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBANKACC_VH1 table
|
IFIBUSPROCESSD-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBUSPROCESSD table
|
IFIDOCJRNLCUBE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIDOCJRNLCUBE table
|
IFIESTDCOSTRUN-CREATIONDATE table field - Date on Which Cost Estimate Was Created
▼
Description: Date on Which Cost Estimate Was Created Field Name: CREATIONDATE Data Element: CK_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIESTDCOSTRUN table
|
IFIGLACCTLITST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTLITST table
|
IFLGHTORDSTRUC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLGHTORDSTRUC table
|
IFMBUDOCITMANC-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBUDOCITMANC table
|
IFMFUNDEDPROGB-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMFUNDEDPROGB table
|
IGMBDGTDOCIANC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMBDGTDOCIANC table
|
IGMGRANTCORETP-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMGRANTCORETP table
|
IINFRECWITHORG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINFRECWITHORG table
|
IINHREPAIRNOTE-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINHREPAIRNOTE table
|
IINSPOPDPCHARC-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPDPCHARC table
|
IINSPRSLTHSTRY-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRSLTHSTRY table
|
IINSPSUBSETTP2-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETTP2 table
|
IINSUBRESVALTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSUBRESVALTP table
|
IJVAOUTREQITEM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJVAOUTREQITEM table
|
ILEINBDELIVITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEINBDELIVITM table
|
ILOGISTCSORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOGISTCSORDER table
|
ILTSTGIRLTDDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILTSTGIRLTDDOC table
|
IMAINTPLANDATA-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTPLANDATA table
|
IMATDOCHEADER2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCHEADER2 table
|
IMATLDOCDELVVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATLDOCDELVVH table
|
IMCRPTENHANC_2-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCRPTENHANC_2 table
|
IMEASPOINTDATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMEASPOINTDATA table
|
IMFGDEFECTHIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGDEFECTHIST table
|
IMFGORDERSPLIT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDERSPLIT table
|
IMFGORDERWSTTS-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDERWSTTS table
|
IMMCPUROACCASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMCPUROACCASS table
|
IMMPURORDAPI01-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDAPI01 table
|
IMPCKTLOPALLOC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPCKTLOPALLOC table
|
IMSTRRCPRELSHP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPRELSHP table
|
IMSTRRCPSECRSC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPSECRSC table
|
IMTITMOBJLTITM-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTITMOBJLTITM table
|
INOTIFTSKTSLTZ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSKTSLTZ table
|
IPPBOOOPBOMICS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPBOMICS table
|
IPPDOCUMENTPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPDOCUMENTPRT table
|
IPPGMOVEXCITEM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPGMOVEXCITEM table
|
IPPMATERIALPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMATERIALPRT table
|
IPPMFGORDOPPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDOPPRT table
|
IPPPRODVERSION-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPPRODVERSION table
|
IPRCHBPOHAPI01-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRCHBPOHAPI01 table
|
IPRDSTORAGELOC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRDSTORAGELOC table
|
IPRJDMNDPURORD-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRJDMNDPURORD table
|
IPROCORDWTHSTS-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCORDWTHSTS table
|
IPRODNRTGSUBOP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRODNRTGSUBOP table
|
IPROPENFORGRTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROPENFORGRTP table
|
IPRVDRCONTRIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRIST table
|
IPRWITHQUAOPEN-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRWITHQUAOPEN table
|
IPSMS4CFIACANC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CFIACANC table
|
IPTSAFTDELCUST-CREATIONDATE table field - Signature PT: Creation Date
▼
Description: Signature PT: Creation Date Field Name: CREATIONDATE Data Element: SIPT_CREADATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPTSAFTDELCUST table
|
IPURCHASECTRWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCHASECTRWD table
|
IPURCONTRDRAFT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCONTRDRAFT table
|
IPURDOCPARTNER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURDOCPARTNER table
|
IPURORDPARTNER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURORDPARTNER table
|
IPURREQNACCTWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNACCTWD table
|
IPURREQNCRTDAT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNCRTDAT table
|
IQLTYDFCTUNION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYDFCTUNION table
|
IQTYCONPREDICT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQTYCONPREDICT table
|
IRETAXCORRITEM-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRETAXCORRITEM table
|
IRFMMASADODITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADODITM table
|
IRTGHDRSRCHMOD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGHDRSRCHMOD table
|
IRTGMATSRCHMOD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGMATSRCHMOD table
|
IRTGPRTSRCHMOD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGPRTSRCHMOD table
|
IRTGSEQSRCHMOD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGSEQSRCHMOD table
|
IRUNOVHDSTATTP-CREATIONDATE table field - Date Overhead document was created
▼
Description: Date Overhead document was created Field Name: CREATIONDATE Data Element: FCO_OVHD_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRUNOVHDSTATTP table
|
ISARUNRULETP_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SUP_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISARUNRULETP_D table
|
ISAVEVERSIONTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAVEVERSIONTP table
|
ISCSHCONCNTP_D-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCSHCONCNTP_D table
|
ISDBILDOCEXITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCEXITM table
|
ISDBILDOCREQIT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCREQIT table
|
ISDBILLDOCITBC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLDOCITBC table
|
ISDCUSTRETITMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETITMC table
|
ISDDOCPROCFLOW-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCPROCFLOW table
|
ISDEFECT_TP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_DR table
|
ISDINVOICELIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDINVOICELIST table
|
ISDSALESDOCBSC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESDOCBSC table
|
ISDSCHEDGAGRMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSCHEDGAGRMT table
|
ISDSLSITMPRPSL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSITMPRPSL table
|
ISDSLSQTANITMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTANITMC table
|
ISESCREATEDATE-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESCREATEDATE table
|
ISFIXEDASSETTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFIXEDASSETTP table
|
ISINSPPLANEDIT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANEDIT table
|
ISIQTYVARTRAIN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISIQTYVARTRAIN table
|
ISLM3TASKSCHDL-CREATIONDATE table field - Creation Date UTC time stamp
▼
Description: Creation Date UTC time stamp Field Name: CREATIONDATE Data Element: ISLM_DE_CREATIONDATE_UTC Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLM3TASKSCHDL table
|
ISLM_ACTIVEHIS-CREATIONDATE table field - Creation Date UTC time stamp
▼
Description: Creation Date UTC time stamp Field Name: CREATIONDATE Data Element: ISLM_DE_CREATIONDATE_UTC Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLM_ACTIVEHIS table
|
ISLSPRVDRCONTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTR table
|
ISMAINTORDERTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERTP table
|
ISPRODUCTWD_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD_DR table
|
ISRFQCOMPARETP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRFQCOMPARETP table
|
ISRVCCONTRFINC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCCONTRFINC table
|
ISSALESORDERTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSALESORDERTP table
|
ISSWCSTRTDATA1-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA1 table
|
ISSWCSTRTDATA2-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA2 table
|
ISSWCSTRTDATA3-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA3 table
|
ISSWCSTRTDATA4-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA4 table
|
ISSWCSTRTDATA5-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA5 table
|
ISSWCSTRTDATA6-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA6 table
|
ISULOSSVERSION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISULOSSVERSION table
|
IVCHHLGRPCSTIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHHLGRPCSTIC table
|
IWLFCUSTSMTITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCUSTSMTITM table
|
IWLFEXPNSMTITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFEXPNSMTITM table
|
IWLFPERSSMTDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFPERSSMTDOC table
|
IWLFSTDCBKDATA-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSTDCBKDATA table
|
IWLFSUPLRSTLST-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRSTLST table
|
I_CUSTOMER_CDS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP I_CUSTOMER_CDS table
|
I_SUPPLIER_CDS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP I_SUPPLIER_CDS table
|
MAINTITEMTXT_D-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITEMTXT_D table
|
MAINTWORKREQ_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTWORKREQ_D table
|
MMPURUI_PR_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPURUI_PR_STY table
|
MMPUR_EXT_EBAN-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBAN table
|
MMPUR_EXT_EBKN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBKN table
|
MMPUR_EXT_EKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EKPO table
|
MMPUR_S_CPO_PO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CPO_PO table
|
MMPUR_S_CPO_PR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CPO_PR table
|
MMPUR_S_PO_DET-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_DET table
|
MMPUR_S_SSP_PR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR table
|
MMPUR_UI_PR_WL-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_UI_PR_WL table
|
MPEV_CER_CAT_T-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEV_CER_CAT_T table
|
MPEV_CER_E_MAT-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPEV_CER_E_MAT table
|
MPE_QUAL_E_MAT-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPE_QUAL_E_MAT table
|
MSR_S_RPO_EKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MSR_S_RPO_EKPO table
|
NCHGRECREFEBOM-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRECREFEBOM table
|
PACTENTPROJACT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTENTPROJACT table
|
PACTENTPROJLED-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PACTENTPROJLED table
|
PAVCXPLANTPVAR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCXPLANTPVAR table
|
PCADEASTCHGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCADEASTCHGLOG table
|
PCADOCCTNPAYDI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCADOCCTNPAYDI table
|
PCCTRITEMMNTR1-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCTRITEMMNTR1 table
|
PCJRNLENTRITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCJRNLENTRITEM table
|
PCNTRLPRITMTYP-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLPRITMTYP table
|
PCONFSLSORDCAQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCONFSLSORDCAQ table
|
PCOSTCTRCHGDOC-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOSTCTRCHGDOC table
|
PDELIVPROCGPAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDELIVPROCGPAD table
|
PDELIVPROCGPTD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDELIVPROCGPTD table
|
PDLVISHAPDELAY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDLVISHAPDELAY table
|
PEBLOGWORKLIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBLOGWORKLIST table
|
PEBORDHAIPC1V2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDHAIPC1V2 table
|
PEBORDHAIPC2V2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDHAIPC2V2 table
|
PEBOVHDERRPROC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBOVHDERRPROC table
|
PEMPLOYEEUNION-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEMPLOYEEUNION table
|
PEPGLACCTRDATA-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEPGLACCTRDATA table
|
PEQUIFLOCUNION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEQUIFLOCUNION table
|
PFIACTPLNSEMUN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIACTPLNSEMUN table
|
PFIGLACCTCDBAL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTCDBAL table
|
PFIGLACCTLITST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITST table
|
PHBPRACCASGNMT-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHBPRACCASGNMT table
|
PINFRECWITHORG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PINFRECWITHORG table
|
PMATLMOVAVGPRC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATLMOVAVGPRC table
|
PMFGDEFECTHIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGDEFECTHIST table
|
PMMPDCNVRTDVAL-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPDCNVRTDVAL table
|
PMMPOCNVRTDVAL-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOCNVRTDVAL table
|
PMMREQTYPEANA0-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMREQTYPEANA0 table
|
PMMREQTYPEANA1-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMREQTYPEANA1 table
|
PPCCOCDCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPCCOCDCHNGLOG table
|
PPOALTSUPLRSIT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOALTSUPLRSIT table
|
PPPPRODVERSLCH-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPPRODVERSLCH table
|
PPREQNCURRCONV-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPREQNCURRCONV table
|
PPRJACTPLNJITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJACTPLNJITM table
|
PPRJBYCMTMTCST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJBYCMTMTCST table
|
PPRJPRTMISMNTH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJPRTMISMNTH table
|
PPRMSGAGEENHCD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRMSGAGEENHCD table
|
PPROJFBDGTSMRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJFBDGTSMRY table
|
PPROJPREDSMMRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJPREDSMMRY table
|
PPROMISETOPAY0-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROMISETOPAY0 table
|
PPROMISETOPAY1-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROMISETOPAY1 table
|
PPROMISETOPAY2-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROMISETOPAY2 table
|
PPROMISETOPAY3-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROMISETOPAY3 table
|
PPROMISETOPAY4-CREATIONDATE table field - Date on Which Promise to Pay Was Given
▼
Description: Date on Which Promise to Pay Was Given Field Name: CREATIONDATE Data Element: BDM_PROMISE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROMISETOPAY4 table
|
PPURCHORDNOSTO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCHORDNOSTO table
|
PPURIFRCNDNSUP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURIFRCNDNSUP table
|
PRACONTRCHGDTE-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRACONTRCHGDTE table
|
PRECRRGSUPPLBA-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FARP_RECURR_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRECRRGSUPPLBA table
|
PRETSLSORDITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRETSLSORDITEM table
|
PROD_S_ROOT_D1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_S_ROOT_D1 table
|
PRTWIPHISTORY1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPHISTORY1 table
|
PRTWIPHISTRLTV-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPHISTRLTV table
|
PSIQTYVARTRAIN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIQTYVARTRAIN table
|
PSLSDOCITEMPAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITEMPAD table
|
PSLSDOCITEMPTD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSDOCITEMPTD table
|
PSLSOWCHATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSOWCHATTRIB table
|
PSRVCDOCFINITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCDOCFINITM table
|
PSRVCDOCREVYRS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCDOCREVYRS table
|
PSRVCINTORDDAT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCINTORDDAT table
|
PSRVENTHEADDAT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVENTHEADDAT table
|
PSRVINTORDCONV-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVINTORDCONV table
|
PURGDOCITEMROW-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURGDOCITEMROW table
|
PURGORDITEMROW-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURGORDITEMROW table
|
QINSPRSLTVAL_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPRSLTVAL_D table
|
QLTYINPRCFAI_D-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYINPRCFAI_D table
|
QLTYINPROCMT_D-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYINPROCMT_D table
|
RECP_FDP_CLERK-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_CLERK table
|
RECP_PARTNER_C-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_PARTNER_C table
|
REXCITF24_DMEE-CREATIONDATE table field - System Date
▼
Description: System Date Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REXCITF24_DMEE table
|
SDPRCG_CNDNR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDPRCG_CNDNR_D table
|
SEPMRA_SO_DRFT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRA_SO_DRFT table
|
SLIM3_S_XML_PA-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SLIM3_S_XML_PA table
|
UKM_ANALYST_DR-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UKM_ANALYST_DR table
|
VDSTOP_VDARL_A-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VDSTOP_VDARL_A table
|
WLF_D_FCADOC_D-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WLF_D_FCADOC_D table
|
WRF_PPW_PPDART-CREATIONDATE table field - Date of Hierarchy Determination
▼
Description: Date of Hierarchy Determination Field Name: CREATIONDATE Data Element: WRF_PPW_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PPW_PPDART table
|
ACRDTBLKDSLSDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACRDTBLKDSLSDOC table
|
ACSWBSELEMENTID-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACSWBSELEMENTID table
|
ACUSTOMERRETURN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACUSTOMERRETURN table
|
AOUTBDELIVERYH1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AOUTBDELIVERYH1 table
|
AOUTBDELIVERYI1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AOUTBDELIVERYI1 table
|
APRODSTORAGELOC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APRODSTORAGELOC table
|
ARETSDELIVERYH1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARETSDELIVERYH1 table
|
ARETSDELIVERYI1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARETSDELIVERYI1 table
|
ASCHAGRMTHEADER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASCHAGRMTHEADER table
|
ASEASONMMPERIOD-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONMMPERIOD table
|
ASEASONPPPERIOD-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONPPPERIOD table
|
ASLSPRCGCNDNMNT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASLSPRCGCNDNMNT table
|
BUSTRANINCOPAYT-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSTRANINCOPAYT table
|
BUSTRANSCLARCSE-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUSTRANSCLARCSE table
|
CADISPPAYMENT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CADISPPAYMENT_D table
|
CARBQTEQOUT_RFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CARBQTEQOUT_RFQ table
|
CASCRTYDEPREQ_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CASCRTYDEPREQ_D table
|
CBDGTENTRYDOCTP-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDGTENTRYDOCTP table
|
CCABUSTRANSBPCH-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANSBPCH table
|
CCABUSTRANSCACH-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANSCACH table
|
CCACORRHDREMAIL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCACORRHDREMAIL table
|
CCADOCWFEMLTMPL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADOCWFEMLTMPL table
|
CCAMSTRDATAITMS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAMSTRDATAITMS table
|
CCAREPAYMENTREQ-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAREPAYMENTREQ table
|
CCBUSTRANOTHPOS-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCBUSTRANOTHPOS table
|
CCHGIMPLNGROUOP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGIMPLNGROUOP table
|
CCHGRCDOBJPGBOM-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGBOM table
|
CCHGRCDOBJPGMAT-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGMAT table
|
CCHGRCDOBJPGPLR-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGPLR table
|
CCHGRCDOBJPGSNP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGSNP table
|
CCHGRCDOBJPGTER-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGTER table
|
CCHGRECPRODNROU-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECPRODNROU table
|
CCSMATRIXRPT01Q-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCSMATRIXRPT01Q table
|
CDAMAGEANALYQRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDAMAGEANALYQRY table
|
CDDFSUPLRINVCVH-CREATIONDATE table field - Document Date
▼
Description: Document Date Field Name: CREATIONDATE Data Element: FAC_DDF_DOCUMENT_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFSUPLRINVCVH table
|
CEBORDHIRTPRCST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBORDHIRTPRCST table
|
CEBORDRTPRODCCG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBORDRTPRODCCG table
|
CEBORDRTPRODCST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEBORDRTPRODCST table
|
CESJIOTBDLIVITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CESJIOTBDLIVITM table
|
CFIJEPOSTWEEKND-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIJEPOSTWEEKND table
|
CFIJEPREVPERIOD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIJEPREVPERIOD table
|
CFIN_AVSO_ITEME-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIN_AVSO_ITEME table
|
CGRCCUSTMSTRCHG-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCCUSTMSTRCHG table
|
CGRCGLACCTCCCHG-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCGLACCTCCCHG table
|
CGRCMATLMSTRCHG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCMATLMSTRCHG table
|
CGRCNOCOCODECUS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNOCOCODECUS table
|
CGRCNOCOCODESUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNOCOCODESUP table
|
CGRCSAMEACCTAMT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCSAMEACCTAMT table
|
CGRCSAMEAMTDESC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCSAMEAMTDESC table
|
CINV_FDP_BANK_2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT_BF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINV_FDP_BANK_2 table
|
CMMINVINBAUCUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMINVINBAUCUBE table
|
CMMPPRSRCITMDEX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPPRSRCITMDEX table
|
CMMPURREQWFLEML-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURREQWFLEML table
|
CMMQTNITEMENHWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMQTNITEMENHWD table
|
CMMSCHAGMTHDDEX-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMSCHAGMTHDDEX table
|
CMM_ROBJ_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_ROBJ_HEADER table
|
CPCHIERHDROBJPG-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCHIERHDROBJPG table
|
CPOMAINTVHOAITM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTVHOAITM table
|
CPPMGAGRMTAPRVL-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAGRMTAPRVL table
|
CPPMGMWRKCNTRBR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGMWRKCNTRBR table
|
CPREBILLDUELIST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPREBILLDUELIST table
|
CPRITEMSFORCONF-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRITEMSFORCONF table
|
CPTDELIVERYNOTE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPTDELIVERYNOTE table
|
CPUBSECBRFMSGTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPUBSECBRFMSGTP table
|
CPURREQHWFDLEML-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQHWFDLEML table
|
CQLTYNOTIFANLYS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNOTIFANLYS table
|
CRAPOSTPONEDRAI-CREATIONDATE table field - Revenue Accounting Item Creation Date
▼
Description: Revenue Accounting Item Creation Date Field Name: CREATIONDATE Data Element: FARR_CDS_RAI_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRAPOSTPONEDRAI table
|
CRCPSRCHITMQTYA-CREATIONDATE table field - Date on Which Object (Item) Was Created
▼
Description: Date on Which Object (Item) Was Created Field Name: CREATIONDATE Data Element: /PLMB/RCP_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRCPSRCHITMQTYA table
|
CRECONTRACTVALQ-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRECONTRACTVALQ table
|
CRFMMASADOESDGI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOESDGI table
|
CRMS4IUVIMIHEAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVIMIHEAD table
|
CRMS4IUVIMOHEAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVIMOHEAD table
|
CRPROMIOBJPGATI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRPROMIOBJPGATI table
|
CRPROMNITMOBJPG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRPROMNITMOBJPG table
|
CRSTLMTACTORDER-CREATIONDATE table field - Last Run or Reversed On
▼
Description: Last Run or Reversed On Field Name: CREATIONDATE Data Element: FCO_SETTLMT_LAST_SETTLED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRSTLMTACTORDER table
|
CRTWIPREPORTING-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTWIPREPORTING table
|
CSAFTNOGLACCBAL-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSAFTNOGLACCBAL table
|
CSDCUSTRETITMQ2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCUSTRETITMQ2 table
|
CSDCUSTRETRATEQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCUSTRETRATEQ table
|
CSDMCCUSTRETITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCCUSTRETITM table
|
CSDMCDBMEREQITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCDBMEREQITM table
|
CSDMCSLSQTANITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSQTANITM table
|
CSDMCSLSSCHAGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSSCHAGMT table
|
CSDPREBILDOCTWL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDPREBILDOCTWL table
|
CSDREVNFRMINVCQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDREVNFRMINVCQ table
|
CSDSDOCITMPEDX1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCITMPEDX1 table
|
CSDSLSCONTRITMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSCONTRITMQ table
|
CSDSLSDOCITMDX1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSDOCITMDX1 table
|
CSDSOWOCWFINBOX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSOWOCWFINBOX table
|
CSLSDOCBYOBJSTS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSDOCBYOBJSTS table
|
CSLSPRCGCNDNRTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSPRCGCNDNRTP table
|
CSLSWOITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSLSWOITMATTRIB table
|
CSSPGLACCOUNTVH-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPGLACCOUNTVH table
|
CSWCSTRTDATAHDR-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSWCSTRTDATAHDR table
|
CTECHOBJCHNHIST-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHOBJCHNHIST table
|
CTECHOBJFLATVH1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHOBJFLATVH1 table
|
CTECHOBJHIERVH1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTECHOBJHIERVH1 table
|
CUKMGRCCLMTCHNG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CUKMGRCCLMTCHNG table
|
CVERSIONHISTORY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CVERSIONHISTORY table
|
CWCBMNTRROYTYCC-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCBMNTRROYTYCC table
|
CWCGRPADMINDATA-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCGRPADMINDATA table
|
CWFTSKCLSDBPQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKCLSDBPQRY table
|
CWFTSKCLSDFIQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKCLSDFIQRY table
|
CWFTSKCLSDPRQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKCLSDPRQRY table
|
CWFTSKOPENBPQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKOPENBPQRY table
|
CWFTSKOPENFIQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKOPENFIQRY table
|
CWFTSKOPENPRQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWFTSKOPENPRQRY table
|
CWLFCUSTSMTFORM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFCUSTSMTFORM table
|
CWLFCUSTSMTITOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFCUSTSMTITOF table
|
CWLFCUSTSTLSTOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFCUSTSTLSTOF table
|
CWLFSDOCOPGITEM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSDOCOPGITEM table
|
CWLFSMTDOCITFRM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSMTDOCITFRM table
|
CWLFSMTDOCLSTOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSMTDOCLSTOF table
|
CWLFSUPBGDITMOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSUPBGDITMOF table
|
CWZREMNTRSETDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWZREMNTRSETDOC table
|
EHPRCS_DOC_INFO-CREATIONDATE table field - 30 Characters
▼
Description: 30 Characters Field Name: CREATIONDATE Data Element: CHAR30 Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CHAR30 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EHPRCS_DOC_INFO table
|
ESHACTIVITYTYPE-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESHACTIVITYTYPE table
|
ESH_L_BUDGETDOC-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_BUDGETDOC table
|
ESH_L_CLFNCHARC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CLFNCHARC table
|
ESH_L_CSTRETDLV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_CSTRETDLV table
|
ESH_L_FUNDS_CTR-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_FUNDS_CTR table
|
ESH_L_INSPSUBS1-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INSPSUBS1 table
|
ESH_L_INSPSUBS2-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INSPSUBS2 table
|
ESH_L_INSPSUBS3-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INSPSUBS3 table
|
ESH_L_INSPSUBS4-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INSPSUBS4 table
|
ESH_L_OUTBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_OUTBDELIV table
|
ESH_L_QLTYNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_QLTYNOTIF table
|
ESH_U_BUDGETDOC-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_BUDGETDOC table
|
ESH_U_CLFNCHARC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CLFNCHARC table
|
ESH_U_CLFNCLASS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CLFNCLASS table
|
ESH_U_CSTRETDLV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CSTRETDLV table
|
ESH_U_FUNDS_CTR-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_FUNDS_CTR table
|
ESH_U_INSPSUBS1-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INSPSUBS1 table
|
ESH_U_INSPSUBS2-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INSPSUBS2 table
|
ESH_U_INSPSUBS3-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INSPSUBS3 table
|
ESH_U_INSPSUBS4-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INSPSUBS4 table
|
ESH_U_OUTBDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_OUTBDELIV table
|
ESH_U_QLTYNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_QLTYNOTIF table
|
FAC_DZVNDRCHGDB-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZVNDRCHGDB table
|
FCO_SETTLSTA_DR-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_SETTLSTA_DR table
|
FISV_TRK_DOC_02-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_TRK_DOC_02 table
|
FISV_TRK_DOC_11-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FISV_TRK_DOC_11 table
|
FITAXMAPDOCPROJ-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FITAXMAPDOCPROJ table
|
GMC_D_GRANT_DFT-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GMC_D_GRANT_DFT table
|
IARNALYSTSLSORD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IARNALYSTSLSORD table
|
IBANKFEESERVMAP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBANKFEESERVMAP table
|
IBNKPAYTINCGSTS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBNKPAYTINCGSTS table
|
IBOODPCHSPECVER-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOODPCHSPECVER table
|
IBOOMATASSIGNCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOOMATASSIGNCS table
|
ICACONTRPARTNER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACONTRPARTNER table
|
ICADOCCTNHEADER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADOCCTNHEADER table
|
ICAINTDOCHEADVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAINTDOCHEADVH table
|
ICAMDDISTRRECDS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDDISTRRECDS table
|
ICAMDOBJWTHSQNC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDOBJWTHSQNC table
|
ICAMDRECDWTHOBJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHOBJ table
|
ICAPRMS2PHEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRMS2PHEADER table
|
ICAPRVDRCONTRTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPRVDRCONTRTR table
|
ICAPYMTLOTDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPYMTLOTDOCVH table
|
ICAPYMTORDDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPYMTORDDOCVH table
|
ICAPYMTRUNDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAPYMTRUNDOCVH table
|
ICAREPAYMENTREQ-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAREPAYMENTREQ table
|
ICAREVDOCPYMTVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAREVDOCPYMTVH table
|
ICAREVERSEDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAREVERSEDOCVH table
|
ICASCRTYDEPMGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICASCRTYDEPMGMT table
|
ICAWORKLISTITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAWORKLISTITEM table
|
ICHFIEXCSTCALOC-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHFIEXCSTCALOC table
|
ICHGIMPLNGROUOP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICHGIMPLNGROUOP table
|
ICJRNLENTRITEME-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICJRNLENTRITEME table
|
ICPURGDOCSLENCD-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPURGDOCSLENCD table
|
ICRDTBLKDSLSDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTBLKDSLSDOC table
|
ICSHCCNMSTRDATA-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICSHCCNMSTRDATA table
|
IEBORDHIRTPRCST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBORDHIRTPRCST table
|
IEBORDRTPRODCCG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBORDRTPRODCCG table
|
IEBORDRTPRODCST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEBORDRTPRODCST table
|
IEFDITMPROCGITM-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEFDITMPROCGITM table
|
IEXRQMTSDMSOITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IEXRQMTSDMSOITM table
|
IFEPRJJRNLENTIT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFEPRJJRNLENTIT table
|
IFIACTPLNSEMTAG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIACTPLNSEMTAG table
|
IFIGLACCINCCODE-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCINCCODE table
|
IFIGLLITSTGLACC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLLITSTGLACC table
|
IFIJOURNALENTIT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIJOURNALENTIT table
|
IFMBDGTDOCBASIC-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMBDGTDOCBASIC table
|
IFUNCTLLOCATION-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNCTLLOCATION table
|
IFUNCTLOCALTLBL-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFUNCTLOCALTLBL table
|
IGHOPNLINKFINAL-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGHOPNLINKFINAL table
|
IGMSPPROGRAMSQL-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGMSPPROGRAMSQL table
|
IHANDLINGUNITHD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHANDLINGUNITHD table
|
IINSPMETHODVERS-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPMETHODVERS table
|
IINSPMETHVERSTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPMETHVERSTP table
|
IINSPOPDPCHARTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPDPCHARTP table
|
IINSPSUBSETRSLT-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETRSLT table
|
IJITPGALOGBASIC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJITPGALOGBASIC table
|
ILECUSTRETDELIV-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILECUSTRETDELIV table
|
ILEDELIVDOCITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEDELIVDOCITEM table
|
ILEOUTBDELIVITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEOUTBDELIVITM table
|
IMAINTITEMBASIC-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEMBASIC table
|
IMAINTITEMFLSTR-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEMFLSTR table
|
IMAINTITEMSTRUC-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTITEMSTRUC table
|
IMAINTNTFTECOBJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNTFTECOBJ table
|
IMAINTORDTECOBJ-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDTECOBJ table
|
IMAINTPLANBASIC-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTPLANBASIC table
|
IMASTERWARRANTY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMASTERWARRANTY table
|
IMFGBOOOPERCHST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOOPERCHST table
|
IMFGCERTCATDESC-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGCERTCATDESC table
|
IMNGRAPSTPNDRAI-CREATIONDATE table field - Revenue Accounting Item Creation Date
▼
Description: Revenue Accounting Item Creation Date Field Name: CREATIONDATE Data Element: FARR_CDS_RAI_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMNGRAPSTPNDRAI table
|
IMSTRRCPCOMPALC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPCOMPALC table
|
IMSTRRCPMTLASGN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: VDM_ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRCPMTLASGN table
|
INFRECWITHORG_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INFRECWITHORG_D table
|
IPCKTLOPALCDATA-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPCKTLOPALCDATA table
|
IPHYSINDSTORLOC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPHYSINDSTORLOC table
|
IPPBILLOFOPERCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBILLOFOPERCS table
|
IPPBOOCHARCVERS-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOCHARCVERS table
|
IPPBOOOPCHARCCS-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPCHARCCS table
|
IPPBOOOPERBASIC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPERBASIC table
|
IPPBOOSUBOPERCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOSUBOPERCS table
|
IPPEQUIPMENTPRT-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPEQUIPMENTPRT table
|
IPRACCASMTAPI01-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCASMTAPI01 table
|
IPRACCTWRKITMWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCTWRKITMWD table
|
IPROJCOSTLINITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJCOSTLINITM table
|
IPROJECTNETWORK-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJECTNETWORK table
|
IPROJECTVERSION-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJECTVERSION table
|
IPROJMLSTNVERSN-CREATIONDATE table field - Milestone created on
▼
Description: Milestone created on Field Name: CREATIONDATE Data Element: MLST_DATEH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJMLSTNVERSN table
|
IPROJNTWKBASDAT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROJNTWKBASDAT table
|
IPSOVERDUEINBCR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSOVERDUEINBCR table
|
IPUBSECBRFMSGTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPUBSECBRFMSGTP table
|
IRECONTRACTBASE-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACTBASE table
|
IREINTOBJECTBSC-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREINTOBJECTBSC table
|
IREREGISTRATION-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREGISTRATION table
|
IRTGOPSEQALCESH-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGOPSEQALCESH table
|
IRTGPRTMSTRDATA-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGPRTMSTRDATA table
|
IRTWIPREPORTING-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTWIPREPORTING table
|
ISAFTBILLHEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAFTBILLHEADER table
|
ISAPARTNER000WD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAPARTNER000WD table
|
ISARUNRULETP_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: SUP_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISARUNRULETP_DR table
|
ISBANKACCOUNTTP-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKACCOUNTTP table
|
ISCHAGMTHDAPI01-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHAGMTHDAPI01 table
|
ISCHEDGAGRMTHDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHEDGAGRMTHDR table
|
ISCOSTELEMENTTP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTELEMENTTP table
|
ISCSHCONCNTP_DR-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCSHCONCNTP_DR table
|
ISDBILLDOCBASIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLDOCBASIC table
|
ISDBILLGDOCITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLGDOCITEM table
|
ISDBILLGDOCITMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLGDOCITMC table
|
ISDCUSTRETITMC2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETITMC2 table
|
ISDCUSTRETRATEA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETRATEA table
|
ISDCUSTRETRATEC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETRATEC table
|
ISDDEBITMEMOREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDEBITMEMOREQ table
|
ISDDELDOCITMANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDELDOCITMANA table
|
ISDSALESDOCITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESDOCITEM table
|
ISDSALESORDERIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESORDERIC table
|
ISDSCHDGAGRMTDS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSCHDGAGRMTDS table
|
ISDSCHEDGAGRMTI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSCHEDGAGRMTI table
|
ISDSLSCONTRITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSCONTRITEM table
|
ISDSLSCONTRITMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSCONTRITMC table
|
ISDSLSDOCEXTITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCEXTITM table
|
ISDSLSDOCITMBSC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITMBSC table
|
ISDSLSORDERITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSORDERITEM table
|
ISDSLSORDSOSTVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSORDSOSTVH table
|
ISDSLSQTANITMC2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTANITMC2 table
|
ISDSOITEMIMPORT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSOITEMIMPORT table
|
ISEASONMMPERIOD-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONMMPERIOD table
|
ISEASONPPPERIOD-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONPPPERIOD table
|
ISEASONSDPERIOD-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONSDPERIOD table
|
ISERVCCONTRPERD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISERVCCONTRPERD table
|
ISFUNDSCENTERTP-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSCENTERTP table
|
ISGRANTCORETP_D-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRANTCORETP_D table
|
ISLSPRCDCNDNRTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRCDCNDNRTP table
|
ISLSPRCGCNDNMNT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRCGCNDNMNT table
|
ISLSPRVDCONTRTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDCONTRTR table
|
ISLSPRVDRCONTRH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTRH table
|
ISLSPRVDRCONTRI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTRI table
|
ISLSPRVDRCTRIVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCTRIVH table
|
ISPRODNVERSTP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODNVERSTP_D table
|
ISPRODUCTWD1_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD1_DR table
|
ISPRODUCTWD2_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTWD2_DR table
|
ISQUALITYTASKTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP table
|
ISRVCCONTRGLCBE-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCCONTRGLCBE table
|
ISRVCCONTRGLCUB-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCCONTRGLCUB table
|
ISRVDOCHEADNOTE-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVDOCHEADNOTE table
|
ISSWCSTRTDATA_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA_D table
|
ISTSBRDFLGHTORD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTSBRDFLGHTORD table
|
ISTSBRDFUNCLLOC-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTSBRDFUNCLLOC table
|
ISUPLRQTNCOMPTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPLRQTNCOMPTP table
|
ISU_C4C_AUDIT_V-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISU_C4C_AUDIT_V table
|
IVARCONFSLSNTVB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSLSNTVB table
|
IVARCONFSLSNTVQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVARCONFSLSNTVQ table
|
IVERSIONHISTORY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVERSIONHISTORY table
|
IWBSELEBYINTKEY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELEBYINTKEY table
|
IWCGRPADMINDATA-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWCGRPADMINDATA table
|
IWLFCSTSMBKDATA-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCSTSMBKDATA table
|
IWLFCSTSMLSBKDT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCSTSMLSBKDT table
|
IWLFCUSTMITMPRT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCUSTMITMPRT table
|
IWLFCUSTSMTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCUSTSMTPART table
|
IWLFEXPNSMTBKDT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFEXPNSMTBKDT table
|
IWLFEXPNSMTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFEXPNSMTPART table
|
IWLFSMTDCBKDATA-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDCBKDATA table
|
IWLFSMTPROCFLOW-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTPROCFLOW table
|
IWLFSPLSMLSBKDT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSPLSMLSBKDT table
|
IWLFSTDOCITPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSTDOCITPART table
|
IWLFSUPLRBGDITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRBGDITM table
|
IWLFSUPLRSMTITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRSMTITM table
|
IWRNTYOBJASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWRNTYOBJASSGMT table
|
KBLE_KMAN_DRAFT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: KBLERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP KBLE_KMAN_DRAFT table
|
LAW2D_USMM_PERS-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2D_USMM_PERS table
|
MITEM_OBJLIST_D-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MITEM_OBJLIST_D table
|
MMPUR_MCPR_S_PO-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_MCPR_S_PO table
|
MMPUR_S_CPO_SES-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CPO_SES table
|
MMPUR_S_GPR_HDR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_GPR_HDR table
|
MMPUR_S_PO_STAT-CREATIONDATE table field - Purchase Order Date
▼
Description: Purchase Order Date Field Name: CREATIONDATE Data Element: BEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_STAT table
|
MMPUR_S_PR_EBAN-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_EBAN table
|
MMPUR_S_QTN_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_HDR table
|
MMPUR_S_RFQ_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RFQ_HDR table
|
NCHGRCDOBJPGPLS-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRCDOBJPGPLS table
|
NGCS_CORE_CHARC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CORE_CHARC table
|
PALLOFUNCAREAVH-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PALLOFUNCAREAVH table
|
PAVCPLSPCFCPVAR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCPLSPCFCPVAR table
|
PAVCPURGDOCITEM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCPURGDOCITEM table
|
PAVCPURGREQNITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCPURGREQNITM table
|
PBRSPEDNFTXRATE-CREATIONDATE table field - Document Creation Date
▼
Description: Document Creation Date Field Name: CREATIONDATE Data Element: LOGBR_CREDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBRSPEDNFTXRATE table
|
PCADOCCTNINVSUM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCADOCCTNINVSUM table
|
PCADOCCTNPAYDIS-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCADOCCTNPAYDIS table
|
PCNTRLPURORDITM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLPURORDITM table
|
PCNTRLWTHPRCHST-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLWTHPRCHST table
|
PEBOVHDERRPROCS-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBOVHDERRPROCS table
|
PFACRA_ACRPOOBJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFACRA_ACRPOOBJ table
|
PFIGLACCOUNTBAL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCOUNTBAL table
|
PFIGLLITSTGLACC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLLITSTGLACC table
|
PIFIGLACOUNTBL2-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIFIGLACOUNTBL2 table
|
PMAINITEMSEARCH-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMAINITEMSEARCH table
|
PMD_S_PROD_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PROD_DATA table
|
PMMCONTRLEAKGPC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCONTRLEAKGPC table
|
PMMPCHGEDOCITEM-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPCHGEDOCITEM table
|
PMMUNUSEDCNTLPC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMUNUSEDCNTLPC table
|
PMNGRAPSTPNDRAI-CREATIONDATE table field - Revenue Accounting Item Creation Date
▼
Description: Revenue Accounting Item Creation Date Field Name: CREATIONDATE Data Element: FARR_CDS_RAI_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNGRAPSTPNDRAI table
|
PMNTRCNTRLPRITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTRCNTRLPRITM table
|
PPOALTSUPLRSIT1-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOALTSUPLRSIT1 table
|
PPOALTSUPLRSIT2-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOALTSUPLRSIT2 table
|
PPOITEMCASTDAMT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMCASTDAMT table
|
PPRDSTORAGELOCD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRDSTORAGELOCD table
|
PPREQITMACCMNTR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPREQITMACCMNTR table
|
PPREQNAVGAPPRVL-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPREQNAVGAPPRVL table
|
PPRITMHIERDFTRN-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRITMHIERDFTRN table
|
PPROCORDMGMTBSC-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROCORDMGMTBSC table
|
PPROJBYMANAGELI-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJBYMANAGELI table
|
PPROJCOSTLINITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJCOSTLINITM table
|
PPROJLASTPREDON-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJLASTPREDON table
|
PPROPENQUANCALC-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROPENQUANCALC table
|
PPURGPRCCNDREC1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGPRCCNDREC1 table
|
PPURGPRCGCNDNSU-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGPRCGCNDNSU table
|
PPURORDITEMMNTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITEMMNTR table
|
PPURREQITEMMNTR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQITEMMNTR table
|
PRD_S_STORAGE_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRD_S_STORAGE_D table
|
PREQNITMSFORCNF-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQNITMSFORCNF table
|
PRTWIPHISTRLTV1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPHISTRLTV1 table
|
PRTWIPORDHDRITM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPORDHDRITM table
|
PSDRETITMBYMNTH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDRETITMBYMNTH table
|
PSETTLASTDOCPRJ-CREATIONDATE table field - Last Run or Reversed On
▼
Description: Last Run or Reversed On Field Name: CREATIONDATE Data Element: FCO_SETTLMT_LAST_SETTLED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSETTLASTDOCPRJ table
|
PSETTLMTLASTDOC-CREATIONDATE table field - Last Run or Reversed On
▼
Description: Last Run or Reversed On Field Name: CREATIONDATE Data Element: FCO_SETTLMT_LAST_SETTLED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSETTLMTLASTDOC table
|
PSETTLMTSNDRDOC-CREATIONDATE table field - Date Document Was Created
▼
Description: Date Document Was Created Field Name: CREATIONDATE Data Element: CO_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSETTLMTSNDRDOC table
|
PSLSPRCGCNDNSUP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSPRCGCNDNSUP table
|
PSLSWOITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSWOITMATTRIB table
|
PSRVCCONTRCTFIN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCCONTRCTFIN table
|
PSRVCCONTRPERDC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCCONTRPERDC table
|
PSRVCDOCCONVITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCDOCCONVITM table
|
PSRVCONTCONVITM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCONTCONVITM table
|
PSUPPLIERCOCODE-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSUPPLIERCOCODE table
|
PVARCONFSLSNTVB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVARCONFSLSNTVB table
|
PVARCONFSLSNTVQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PVARCONFSLSNTVQ table
|
P_BKPAYTLASTREF-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_BKPAYTLASTREF table
|
P_UMM3TASKSCHDL-CREATIONDATE table field - Creation Date UTC time stamp
▼
Description: Creation Date UTC time stamp Field Name: CREATIONDATE Data Element: RSANA_UMM_CREATIONDATE_UTC Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP P_UMM3TASKSCHDL table
|
QINSPSUBSETRR_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPSUBSETRR_D table
|
RCRDTMANALYSTDR-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCRDTMANALYSTDR table
|
REVTBSDPOSTGERR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REVTBSDPOSTGERR table
|
REXCITF24_ITEMS-CREATIONDATE table field - System Date
▼
Description: System Date Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REXCITF24_ITEMS table
|
ROIO_SC_CONTEXT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_SC_CONTEXT table
|
ROIO_SC_CONTEXT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_SC_CONTEXT table
|
S_SCLT_CUSTUSER-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP S_SCLT_CUSTUSER table
|
TDS_BD_SLS_HEAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_SLS_HEAD table
|
VCH_APRIORI_RES-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_APRIORI_RES table
|
WB2_ALV_PO_ITEM-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_ALV_PO_ITEM table
|
WLF_D_FCAITEM_D-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WLF_D_FCAITEM_D table
|
WSUBST_EKPO_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSUBST_EKPO_STY table
|
/BSNAGT/CV_STEPS-CREATIONDATE table field - Creation Date (System)
▼
Description: Creation Date (System) Field Name: CREATIONDATE Data Element: /BSNAGT/CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BSNAGT/CV_STEPS table
|
/DMBE/IAUDITJOIN-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/IAUDITJOIN table
|
/DMBE/IBUSPARTSE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/IBUSPARTSE table
|
/PF1/CV_PAYAGRMT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /PF1/DTE_BPE_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PF1/CV_PAYAGRMT table
|
/PF1/CV_PAYRULES-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /PF1/DTE_BPE_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PF1/CV_PAYRULES table
|
/PF1/CV_RULESETS-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /PF1/DTE_BPE_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PF1/CV_RULESETS table
|
/PLMI/C_ER_STDHD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/C_ER_STDHD table
|
/PLMI/SW_CSTRT_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/SW_CSTRT_D table
|
/SAPPO/ORDER_HDR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/ORDER_HDR table
|
/SAPPO/V_PPOCMPL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/V_PPOCMPL table
|
ABUSINESSPARTNER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABUSINESSPARTNER table
|
ACLFNPRODSTORLOC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACLFNPRODSTORLOC table
|
ACSTRANSDATARPTG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FINCS_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACSTRANSDATARPTG table
|
AFIINTERNALORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIINTERNALORDER table
|
AINBDELIVERYITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINBDELIVERYITEM table
|
APINRPRCGCNDNREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APINRPRCGCNDNREC table
|
APINRPRCGNCDNSUP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APINRPRCGNCDNSUP table
|
API_KANBANCTRCYC-CREATIONDATE table field - Creation Date of Kanban Control Cycle
▼
Description: Creation Date of Kanban Control Cycle Field Name: CREATIONDATE Data Element: VDM_CRE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP API_KANBANCTRCYC table
|
APURGPRCGCNDNREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURGPRCGCNDNREC table
|
APURGPRCGNCDNSUP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURGPRCGNCDNSUP table
|
ASDSCHEDGAGRMTDS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASDSCHEDGAGRMTDS table
|
ASEASONSDPERIODS-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASEASONSDPERIODS table
|
ASLSPRCGCNDNRECD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASLSPRCGCNDNRECD table
|
BDGT_D_HDR_DRAFT-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BDGT_D_HDR_DRAFT table
|
CALCTBLITEMOBJPG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALCTBLITEMOBJPG table
|
CALLOCTABLEOBJPG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CALLOCTABLEOBJPG table
|
CARPROCFLOWBLDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CARPROCFLOWBLDOC table
|
CARPROCFLOWSDDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CARPROCFLOWSDDOC table
|
CBDGTDOCHEADERTP-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBDGTDOCHEADERTP table
|
CBNKPAYMENTBATCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBNKPAYMENTBATCH table
|
CBUSINESSPARTNER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CBUSINESSPARTNER table
|
CCABUSTRANDUNEXP-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANDUNEXP table
|
CCABUSTRANINVOIC-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANINVOIC table
|
CCABUSTRANSDOCCH-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCABUSTRANSDOCCH table
|
CCADISPPAYMENTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCADISPPAYMENTTP table
|
CCAMSTRDATADISTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCAMSTRDATADISTR table
|
CCBUSTRANDBTENTR-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCBUSTRANDBTENTR table
|
CCBUSTRANSINSPLN-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_BT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCBUSTRANSINSPLN table
|
CCHGRCDOBJPGBOMI-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGBOMI table
|
CCHGRCDOBJPGSPEC-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRCDOBJPGSPEC table
|
CCHGRECREFMBOMTP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCHGRECREFMBOMTP table
|
CCNTRLCITMPRCHST-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLCITMPRCHST table
|
CCRDTDCSNSLSORDQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCRDTDCSNSLSORDQ table
|
CCTRLGSETTLMTDOC-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRLGSETTLMTDOC table
|
CDDFBILLINGDOCVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDDFBILLINGDOCVH table
|
CFIACCDOCCHNGLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFIACCDOCCHNGLOG table
|
CFICOSTCTRACTTYP-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFICOSTCTRACTTYP table
|
CGRCCLINVPDWTHTG-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCCLINVPDWTHTG table
|
CGRCCUSMSTRCCCHG-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCCUSMSTRCCCHG table
|
CGRCDELPSTBLKCUS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCDELPSTBLKCUS table
|
CGRCDELPSTBLKSUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCDELPSTBLKSUP table
|
CGRCDSBDPLINVSUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCDSBDPLINVSUP table
|
CGRCDSONETIMEASP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCDSONETIMEASP table
|
CGRCERSACTVTDSUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCERSACTVTDSUP table
|
CGRCGLACCTCOACHG-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCGLACCTCOACHG table
|
CGRCINVPDWTTGDRC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCINVPDWTTGDRC table
|
CGRCMNLPSTGLACCT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCMNLPSTGLACCT table
|
CGRCNOCLRGCUSSUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNOCLRGCUSSUP table
|
CGRCNOPAYTMETSUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNOPAYTMETSUP table
|
CGRCNOPAYTTERCUS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCNOPAYTTERCUS table
|
CGRCRECNCACCTCUS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCRECNCACCTCUS table
|
CGRCRECNCACCTSUP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCRECNCACCTSUP table
|
CGRCSAMEACCTDESC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCSAMEACCTDESC table
|
CGRCSUPLRMSTRCHG-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCSUPLRMSTRCHG table
|
CGRCSUPMSTRCCCHG-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCSUPMSTRCCCHG table
|
CGRCUNLMTDELIVPO-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCUNLMTDELIVPO table
|
CGRCUSRCRESUPINV-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCUSRCRESUPINV table
|
CGRCUSRCRESUPPUR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRCUSRCRESUPPUR table
|
CHCTRVERSHISTORY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CHCTRVERSHISTORY table
|
CLISTCNDNPRODUCT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLISTCNDNPRODUCT table
|
CMATDOCPRINTGISC-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATDOCPRINTGISC table
|
CMATDOCPRINTGMVT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATDOCPRINTGMVT table
|
CMATDOCRESDOCITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATDOCRESDOCITM table
|
CMDQLTYPRODPLRES-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMDQLTYPRODPLRES table
|
CMFGCERTMATLASGN-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGCERTMATLASGN table
|
CMMFDAI_S_AIFLOG-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFDAI_S_AIFLOG table
|
CMMFSA_S_SUBACCT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMFSA_S_SUBACCT table
|
CMMINVINBAUTMNRT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMINVINBAUTMNRT table
|
CMMPURINFORECDEX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURINFORECDEX table
|
CNODSPUTDCLRDDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNODSPUTDCLRDDOC table
|
CNOTDSPUTDOPNDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNOTDSPUTDOPNDOC table
|
COBDELDITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COBDELDITMATTRIB table
|
COBJPGMAINTNOTIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COBJPGMAINTNOTIF table
|
COVERDUESITNANCR-CREATIONDATE table field - Purchase Order Posting Date
▼
Description: Purchase Order Posting Date Field Name: CREATIONDATE Data Element: MMIM_PO_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COVERDUESITNANCR table
|
COVERDUESITNTRGR-CREATIONDATE table field - Purchase Order Posting Date
▼
Description: Purchase Order Posting Date Field Name: CREATIONDATE Data Element: MMIM_PO_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COVERDUESITNTRGR table
|
CPLANTMRPPLNGCYC-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPLANTMRPPLNGCYC table
|
CPOMAINTVHCTRITM-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTVHCTRITM table
|
CPPMGAGRMWRKCNTR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPPMGAGRMWRKCNTR table
|
CPRHIACCTASSMTWI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRHIACCTASSMTWI table
|
CPRODSPLYCTRLCYC-CREATIONDATE table field - Creation Date of Kanban Control Cycle
▼
Description: Creation Date of Kanban Control Cycle Field Name: CREATIONDATE Data Element: VDM_CRE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRODSPLYCTRLCYC table
|
CRECRRGINVCTMPLR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FARP_RECURR_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRECRRGINVCTMPLR table
|
CRETDELITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRETDELITMATTRIB table
|
CRFMMASADOEDTSDH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOEDTSDH table
|
CRFMMASADOEDTSDI-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOEDTSDI table
|
CRFMMASADOGENITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMMASADOGENITM table
|
CRFMPRVSNLGNRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRFMPRVSNLGNRITM table
|
CRMS4IUVPCONPAFL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4IUVPCONPAFL table
|
CRMS4S_EQUIPMENT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUIPMENT table
|
CRMS4S_FUNLOC_IL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_FUNLOC_IL table
|
CRMS4S_IU_PRD_BL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_BL table
|
CRTWIPLMONTHHIST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTWIPLMONTHHIST table
|
CRTWIPRLTVDAYHST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRTWIPRLTVDAYHST table
|
CSBSCRPITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSBSCRPITMATTRIB table
|
CSDBDOCITMPEBCDX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBDOCITMPEBCDX table
|
CSDBDOCITMPECDX1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBDOCITMPECDX1 table
|
CSDBILDOCITMBCDX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBILDOCITMBCDX table
|
CSDBILDOCITMBDX1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDBILDOCITMBDX1 table
|
CSDCRDMEMREQITMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDCRDMEMREQITMQ table
|
CSDDEBMEMREQITMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDDEBMEMREQITMQ table
|
CSDEXCINVPNDOTHR-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDEXCINVPNDOTHR table
|
CSDMCSLSAGSCHDLN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSAGSCHDLN table
|
CSDMCSLSCONTRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSCONTRITM table
|
CSDMCSLSORDSCHDL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSORDSCHDL table
|
CSDMCSLSORDWOITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSORDWOITM table
|
CSDMCSLSORDWTCHR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSORDWTCHR table
|
CSDMCSLSSCAGMITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMCSLSSCAGMITM table
|
CSDMLPROCFLOWDEX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDMLPROCFLOWDEX table
|
CSDSCHEDGAGRMTIQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSCHEDGAGRMTIQ table
|
CSDSDOCSCHDLNDX1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCSCHDLNDX1 table
|
CSDSDOCSCHEDLNDX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSDOCSCHEDLNDX table
|
CSDSLSORDDLVPRFQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSORDDLVPRFQ table
|
CSDSLSORDERITEMQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSORDERITEMQ table
|
CSDSLSQTANITMQRY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSDSLSQTANITMQRY table
|
CSETTLMNTACTPROJ-CREATIONDATE table field - Last Run or Reversed On
▼
Description: Last Run or Reversed On Field Name: CREATIONDATE Data Element: FCO_SETTLMT_LAST_SETTLED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETTLMNTACTPROJ table
|
CSETTLMNTACTSTAT-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSETTLMNTACTSTAT table
|
CSRVCCONTRFINQRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCCONTRFINQRY table
|
CSRVCCONTRFINQY2-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCCONTRFINQY2 table
|
CSRVCNFITMATTRIB-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRMS4_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCNFITMATTRIB table
|
CSTTLMNTACTMNTOR-CREATIONDATE table field - Last Run or Reversed On
▼
Description: Last Run or Reversed On Field Name: CREATIONDATE Data Element: FCO_SETTLMT_LAST_SETTLED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSTTLMNTACTMNTOR table
|
CSUPEVALSCARDDST-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SRMSMC/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSUPEVALSCARDDST table
|
CTRLPURREQHWFEML-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRLPURREQHWFEML table
|
CTRLPURREQWFLEML-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRLPURREQWFLEML table
|
CTTTUTRACKTOOLTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTTTUTRACKTOOLTP table
|
CWCBMNGCUSTCONTR-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCBMNGCUSTCONTR table
|
CWCBMNGSUPLRCONT-CREATIONDATE table field - Date of Condition Contract Creation
▼
Description: Date of Condition Contract Creation Field Name: CREATIONDATE Data Element: WCB_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWCBMNGSUPLRCONT table
|
CWLFEXPNSMTITMOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFEXPNSMTITMOF table
|
CWLFSUPLRSMTITOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSUPLRSMTITOF table
|
CWLFSUPLRSTLSTOF-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CWLFSUPLRSTLSTOF table
|
DAC_S_TRACE_4042-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DAC_S_TRACE_4042 table
|
DAC_S_TRACE_4081-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DAC_S_TRACE_4081 table
|
DAC_S_TRACE_4082-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DAC_S_TRACE_4082 table
|
DAC_S_TRACE_4083-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DAC_S_TRACE_4083 table
|
DAC_S_TRACE_4084-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DAC_S_TRACE_4084 table
|
ESHACTIVITYTYPEB-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESHACTIVITYTYPEB table
|
ESH_L_ACTYTYPEV2-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_ACTYTYPEV2 table
|
ESH_L_BDGTDOC_OP-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_BDGTDOC_OP table
|
ESH_L_COMMIT_ITM-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_COMMIT_ITM table
|
ESH_L_DOCINFOREC-CREATIONDATE table field - Time Document Was Created
▼
Description: Time Document Was Created Field Name: CREATIONDATE Data Element: DMS_CREATED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_DOCINFOREC table
|
ESH_L_FUNDED_PRG-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_FUNDED_PRG table
|
ESH_L_INCINVOICE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INCINVOICE table
|
ESH_L_INSPSUBSET-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_INSPSUBSET table
|
ESH_L_PAYADVICES-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_PAYADVICES table
|
ESH_L_PERSSMTDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_PERSSMTDOC table
|
ESH_L_SALESCHEDG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_SALESCHEDG table
|
ESH_L_SPONSOR_CL-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_SPONSOR_CL table
|
ESH_L_SPONSOR_PR-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_SPONSOR_PR table
|
ESH_U_ACTYTYPEV2-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_ACTYTYPEV2 table
|
ESH_U_BDGTDOC_OP-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_BDGTDOC_OP table
|
ESH_U_CAPYLOTHDR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_CAPYLOTHDR table
|
ESH_U_COMMIT_ITM-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_COMMIT_ITM table
|
ESH_U_DOCINFOREC-CREATIONDATE table field - Time Document Was Created
▼
Description: Time Document Was Created Field Name: CREATIONDATE Data Element: DMS_CREATED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_DOCINFOREC table
|
ESH_U_FUNDED_PRG-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_FUNDED_PRG table
|
ESH_U_INCINVOICE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INCINVOICE table
|
ESH_U_INSPSUBSET-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_INSPSUBSET table
|
ESH_U_PAYADVICES-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_PAYADVICES table
|
ESH_U_PERSSMTDOC-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_PERSSMTDOC table
|
ESH_U_SALESCHEDG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_SALESCHEDG table
|
ESH_U_SPONSOR_CL-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_SPONSOR_CL table
|
ESH_U_SPONSOR_PR-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_SPONSOR_PR table
|
FAC_DZGLLDGRITEM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZGLLDGRITEM table
|
FAC_DZJOURNALENT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZJOURNALENT table
|
FAC_DZVNDRCHGDBB-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZVNDRCHGDBB table
|
FAC_DZVNDRCHGDOC-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_DZVNDRCHGDOC table
|
FAC_S_IFIGL_JRNL-CREATIONDATE table field - Journal Entry Creation Date
▼
Description: Journal Entry Creation Date Field Name: CREATIONDATE Data Element: FIS_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_IFIGL_JRNL table
|
FAP_RSIV_TMPLR_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FARP_RECURR_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAP_RSIV_TMPLR_D table
|
FCOT_EBPR_RUL_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCOT_EBPR_RUL_DR table
|
FCO_ACTIVITYTYPE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_ACTIVITYTYPE table
|
FINCSJRNLENTRH_D-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCSJRNLENTRH_D table
|
FINCSJRNLENTRI_D-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCSJRNLENTRI_D table
|
FINCS_S_JE_DRAFT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_JE_DRAFT table
|
FINOCV_RTSOIMNTH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINOCV_RTSOIMNTH table
|
FMAPPLOFFD_DRAFT-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMAPPLOFFD_DRAFT table
|
FMBDGTPERD_DRAFT-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMBDGTPERD_DRAFT table
|
FMCOMMITEM_DRAFT-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMCOMMITEM_DRAFT table
|
FMC_D_BDGTPD_DFT-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMC_D_BDGTPD_DFT table
|
FMC_D_FUNCAR_DFT-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMC_D_FUNCAR_DFT table
|
FMFUNCAREA_DRAFT-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMFUNCAREA_DRAFT table
|
FMFUNDEDPR_DRAFT-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMFUNDEDPR_DRAFT table
|
FMFUNDSCTR_DRAFT-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FMFUNDSCTR_DRAFT table
|
IALIGNAASLPURITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNAASLPURITM table
|
IALIGNAASLSITMSL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALIGNAASLSITMSL table
|
IALLOCATIONTABLE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IALLOCATIONTABLE table
|
IBDGTDOCHEADERTP-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTDOCHEADERTP table
|
IBDGTENTRYDOCHTP-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBDGTENTRYDOCHTP table
|
IBILLDUELISTITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBILLDUELISTITEM table
|
IBNKPAYMENTBATCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBNKPAYMENTBATCH table
|
IBOOCINSPSPUNION-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBOOCINSPSPUNION table
|
IBPCUSTCNTCTLINK-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPCUSTCNTCTLINK table
|
IBPSUPLRCNTCLINK-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBPSUPLRCNTCLINK table
|
IBUSINESSPARTNER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBUSINESSPARTNER table
|
ICACORRESPNCHEAD-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACORRESPNCHEAD table
|
ICACORRESPNCHIST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICACORRESPNCHIST table
|
ICADISPPAYMENTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICADISPPAYMENTTP table
|
ICAMDRECDWTHRATG-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAMDRECDWTHRATG table
|
ICAWRITEOFFDOCVH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICAWRITEOFFDOCVH table
|
ICFGGROUPCSTICWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICFGGROUPCSTICWD table
|
ICNTRLPCTRHAPI01-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCTRHAPI01 table
|
ICONFFAILDCOCALC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICONFFAILDCOCALC table
|
ICRDTACCTANALYST-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTACCTANALYST table
|
ICRDTACCTRELSHIP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTACCTRELSHIP table
|
ICRDTDCSNSLSORDC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICRDTDCSNSLSORDC table
|
ICTRLGOBJSETRULE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: BRGERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRLGOBJSETRULE table
|
ICTRLGSETTLMTDOC-CREATIONDATE table field - Date Document Was Created
▼
Description: Date Document Was Created Field Name: CREATIONDATE Data Element: CO_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTRLGSETTLMTDOC table
|
ICVDOCINFRCSRCHM-CREATIONDATE table field - Time Document Was Created
▼
Description: Time Document Was Created Field Name: CREATIONDATE Data Element: DMS_CREATED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCINFRCSRCHM table
|
ICVDOCSTRUCTITEM-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCSTRUCTITEM table
|
IDAMAGEANALYCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDAMAGEANALYCUBE table
|
IENGPROJCUSTINFO-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IENGPROJCUSTINFO table
|
IFAILDGMOVEXCITM-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFAILDGMOVEXCITM table
|
IFAILEDORDCONFGR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFAILEDORDCONFGR table
|
IFIAPGLACCLITSTG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIAPGLACCLITSTG table
|
IFIAPGLACCTLITST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIAPGLACCTLITST table
|
IFIBAMCHGREQUEST-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIBAMCHGREQUEST table
|
IFIGLACCTYTDBALC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIGLACCTYTDBALC table
|
IFIINTERNALORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFIINTERNALORDER table
|
IFLOCLABELINTERN-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLOCLABELINTERN table
|
IGHOPNDELLINKLOG-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGHOPNDELLINKLOG table
|
IGOODSMVMTDOCDEX-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGOODSMVMTDOCDEX table
|
IICLCLMTASKINQRY-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IICLCLMTASKINQRY table
|
IICLTASKSPENDING-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IICLTASKSPENDING table
|
IINFRECWITHORGWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINFRECWITHORGWD table
|
IINHREPAITEMNOTE-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINHREPAITEMNOTE table
|
IINSPLOTMATLDOCI-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPLOTMATLDOCI table
|
IINSPPLOPASSGVRS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLOPASSGVRS table
|
IINSPRESULTVALUE-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRESULTVALUE table
|
IINSPRSLTVALDVAL-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRSLTVALDVAL table
|
IINSPSAMPLERESTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSAMPLERESTP table
|
IJPINVCSUMMARYVA-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: ISJPCREADATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: ISJPCREADATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJPINVCSUMMARYVA table
|
ILECUSTRTELIVITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILECUSTRTELIVITM table
|
ILEDELIVDOCITEMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILEDELIVDOCITEMC table
|
IMAINTNOTIFCAUSE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTNOTIFCAUSE table
|
IMAINTTASKLISTTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTTASKLISTTP table
|
IMATDOCREC4PRINT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCREC4PRINT table
|
IMCFNDNENHANCUBE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMCFNDNENHANCUBE table
|
IMDOSUBSCRIPTION-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: MDO_CREATIONDATE Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMDOSUBSCRIPTION table
|
IMFBOOSEQOPASSCS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFBOOSEQOPASSCS table
|
IMFGBILLOFOPERCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBILLOFOPERCS table
|
IMFGBOOMATASGNCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOMATASGNCS table
|
IMFGBOOOPBOMITCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOOPBOMITCS table
|
IMFGBOOOPPRTCHST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOOPPRTCHST table
|
IMFGBOOSEQNCCHST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOSEQNCCHST table
|
IMFGBOOSUBOPCHST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBOOSUBOPCHST table
|
IMFGCERTCATEGORY-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGCERTCATEGORY table
|
IMFGCERTMATLASGN-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGCERTMATLASGN table
|
IMFGORDMATDOCITM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDMATDOCITM table
|
IMFGORDOPTRGGRPT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDOPTRGGRPT table
|
IMMPURCHASEORDER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURCHASEORDER table
|
IMMPURCHASINGDOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURCHASINGDOC table
|
IMMPURSCHAGRMAIL-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURSCHAGRMAIL table
|
IMTORDOBJLISTITM-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMTORDOBJLISTITM table
|
INODSPUTDCLRDDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INODSPUTDCLRDDOC table
|
INODSPUTDCLRDITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INODSPUTDCLRDITM table
|
INOTDSPUTDOPNDOC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTDSPUTDOPNDOC table
|
INOTDSPUTDOPNITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTDSPUTDOPNITM table
|
INTFCAUSETECHOBJ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INTFCAUSETECHOBJ table
|
IORDPRODNRSCTOOL-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IORDPRODNRSCTOOL table
|
IPACKINSTRHEADER-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: PL_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPACKINSTRHEADER table
|
IPAYTADVCFRMASGN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPAYTADVCFRMASGN table
|
IPLANTMAINTPARTN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPLANTMAINTPARTN table
|
IPPBOOOPDCHARCCS-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPDCHARCCS table
|
IPPBOOOPDOCPRTCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPDOCPRTCS table
|
IPPBOOOPEQUPRTCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPEQUPRTCS table
|
IPPBOOOPMATPRTCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPMATPRTCS table
|
IPPBOOOPMISPRTCS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOOPMISPRTCS table
|
IPPBOOSEQOPASSCS-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOSEQOPASSCS table
|
IPPBOOSEQUENCECS-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBOOSEQUENCECS table
|
IPPCONTROLRECIPE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPCONTROLRECIPE table
|
IPPDOCUMENTPRTIK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPDOCUMENTPRTIK table
|
IPPLINEHIERARCHY-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPLINEHIERARCHY table
|
IPPMATERIALPRTIK-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMATERIALPRTIK table
|
IPPMRPPLNGPERIOD-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMRPPLNGPERIOD table
|
IPRACCASGMTAPI01-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRACCASGMTAPI01 table
|
IPRDSTORAGELOCWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRDSTORAGELOCWD table
|
IPRDSTORLOCBASIC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRDSTORLOCBASIC table
|
IPRHDITACTWRKITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRHDITACTWRKITM table
|
IPRHRITACWRKITWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRHRITACWRKITWD table
|
IPRJMATCOMBASDAT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRJMATCOMBASDAT table
|
IPRMTHBPRITAPI01-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITAPI01 table
|
IPRMTHBRPLPOMAIL-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBRPLPOMAIL table
|
IPROCESSROUTTMPL-CREATIONDATE table field - Date Process Route Created
▼
Description: Date Process Route Created Field Name: CREATIONDATE Data Element: SRMWFCRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCESSROUTTMPL table
|
IPROCMTHUBPRITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCMTHUBPRITEM table
|
IPROCORDMGMTCALC-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCORDMGMTCALC table
|
IPROCORDMGMTLIST-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCORDMGMTLIST table
|
IPRSSPACCTASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPACCTASSGMT table
|
IPRVDRCONTRIDISC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRVDRCONTRIDISC table
|
IPSCONTRACTBPACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSCONTRACTBPACC table
|
IPSMS4CCOMACTANC-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPSMS4CCOMACTANC table
|
IPURGDOCPARTNENH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCPARTNENH table
|
IPURGDOCSUPLCONF-CREATIONDATE table field - Creation Date of Confirmation
▼
Description: Creation Date of Confirmation Field Name: CREATIONDATE Data Element: BBERD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSUPLCONF table
|
IPURGPRCGCNDNREC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGPRCGCNDNREC table
|
IPURGPRCGNCDNSUP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGPRCGNCDNSUP table
|
IPURORDPARTAPI01-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURORDPARTAPI01 table
|
IQLTYNOTIFKFCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNOTIFKFCUBE table
|
IQUALMATASSMTBSC-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQUALMATASSMTBSC table
|
IQUALWCASSGMTBSC-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQUALWCASSGMTBSC table
|
IRECONTRACTVALID-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECONTRACTVALID table
|
IRECRRGINVCTMPLR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FARP_RECURR_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRECRRGINVCTMPLR table
|
IREREGISTRATDONE-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREGISTRATDONE table
|
IREREGISTRATMERG-CREATIONDATE table field - First Entered On
▼
Description: First Entered On Field Name: CREATIONDATE Data Element: DERF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREREGISTRATMERG table
|
IRFMMASADOGENITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASADOGENITM table
|
IRFMMASTERORDDUR-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMMASTERORDDUR table
|
IRFMPRVSNLDOCITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLDOCITM table
|
IRFMPRVSNLGNRITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRFMPRVSNLGNRITM table
|
IRTGCMPALCSRHMOD-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGCMPALCSRHMOD table
|
ISBUDGETPERIODTP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETPERIODTP table
|
ISCHDGAGRMTPRTNR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHDGAGRMTPRTNR table
|
ISCHEDGAGRM000WD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHEDGAGRM000WD table
|
ISCHEDGAGRMTENHD-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHEDGAGRMTENHD table
|
ISDBILDITMBSCANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDITMBSCANA table
|
ISDBILDOCITMEBAS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILDOCITMEBAS table
|
ISDBILLDOCITMANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBILLDOCITMANA table
|
ISDBLNPLNDDTEANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDBLNPLNDDTEANA table
|
ISDCRDMEMOREQITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCRDMEMOREQITM table
|
ISDCRDMEMREQITMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCRDMEMREQITMC table
|
ISDCREDITMEMOREQ-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCREDITMEMOREQ table
|
ISDCRITMENHANCED-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCRITMENHANCED table
|
ISDCUSTRETURNITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDCUSTRETURNITM table
|
ISDDEBMEMOREQITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDEBMEMOREQITM table
|
ISDDEBMEMREQITMC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDEBMEMREQITMC table
|
ISDDOCMLPROCFLOW-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCMLPROCFLOW table
|
ISDDOCPROCFLOWPT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDDOCPROCFLOWPT table
|
ISDPREBILDITMANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDPREBILDITMANA table
|
ISDPREBILDOCITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDPREBILDOCITEM table
|
ISDSALESCONTRACT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSALESCONTRACT table
|
ISDSCHEDGAGRMTIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSCHEDGAGRMTIC table
|
ISDSCHEDLINENANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSCHEDLINENANA table
|
ISDSLSCONTITMANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSCONTITMANA table
|
ISDSLSDOCITMANTS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSDOCITMANTS table
|
ISDSLSITMPRPSLIM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSITMPRPSLIM table
|
ISDSLSORDDLVPRFC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSORDDLVPRFC table
|
ISDSLSQTANITMANA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSLSQTANITMANA table
|
ISDSOWTHOCHRGITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDSOWTHOCHRGITM table
|
ISEASONBASICTEXT-CREATIONDATE table field - Date on Which the Object Was Created
▼
Description: Date on Which the Object Was Created Field Name: CREATIONDATE Data Element: FSH_CREATEDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISEASONBASICTEXT table
|
ISETTLMNTACTSTAT-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISETTLMNTACTSTAT table
|
ISFIXEDASSETTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFIXEDASSETTP_D table
|
ISGRANTCORETP_DR-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: GM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: GM_CREATED_ON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGRANTCORETP_DR table
|
ISINVCHGDOCAPI01-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINVCHGDOCAPI01 table
|
ISLSPRCGCNDNRECD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRCGCNDNRECD table
|
ISLSPRVDRCONTRVH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISLSPRVDRCONTRVH table
|
ISMAINTORDERTP_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERTP_D table
|
ISPRODNVERSTP_DR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODNVERSTP_DR table
|
ISRFQCOMPARETP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRFQCOMPARETP_D table
|
ISSALESORDERTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSALESORDERTP_D table
|
ISSWCSTRTDATA1_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA1_D table
|
ISSWCSTRTDATA2_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA2_D table
|
ISSWCSTRTDATA3_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA3_D table
|
ISSWCSTRTDATA4_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA4_D table
|
ISSWCSTRTDATA5_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA5_D table
|
ISSWCSTRTDATA6_D-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSWCSTRTDATA6_D table
|
ISTANDARDPROJECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTANDARDPROJECT table
|
ISUPPLIERINVOICE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPPLIERINVOICE table
|
ITECHNICALO000TP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITECHNICALO000TP table
|
ITECHNICALOBJECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITECHNICALOBJECT table
|
ITRSYPOSTRANSFLW-CREATIONDATE table field - Creation Date of the Operative Business Transaction
▼
Description: Creation Date of the Operative Business Transaction Field Name: CREATIONDATE Data Element: TPM_BT_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRSYPOSTRANSFLW table
|
ITSKLSTTOEQALLOC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITSKLSTTOEQALLOC table
|
ITSKLSTTOFLALLOC-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITSKLSTTOFLALLOC table
|
IVCHHLGRPKEYDATE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IVCHHLGRPKEYDATE table
|
IWBSELEMENTIDENH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELEMENTIDENH table
|
IWBSELEMENTVERSN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELEMENTVERSN table
|
IWBSELMNTBSCDATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWBSELMNTBSCDATA table
|
IWLFCSTSMTLTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFCSTSMTLTPART table
|
IWLFEXPNSMTITMPT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFEXPNSMTITMPT table
|
IWLFPERSMTDOCITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFPERSMTDOCITM table
|
IWLFSMTCMPLTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTCMPLTPART table
|
IWLFSMTDCLSTBKDT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDCLSTBKDT table
|
IWLFSMTDCLSTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDCLSTPART table
|
IWLFSMTDCPARTNER-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTDCPARTNER table
|
IWLFSMTITPARTNER-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTITPARTNER table
|
IWLFSMTMGTDOCITM-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSMTMGTDOCITM table
|
IWLFSPBDOCBKDATA-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSPBDOCBKDATA table
|
IWLFSPLSMTLTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSPLSMTLTPART table
|
IWLFSUPBDCITMPRT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPBDCITMPRT table
|
IWLFSUPLRMITMPRT-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRMITMPRT table
|
IWLFSUPLRSMTPART-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLRSMTPART table
|
IWLFSUPLSMBKDATA-CREATIONDATE table field - Date of Document Creation
▼
Description: Date of Document Creation Field Name: CREATIONDATE Data Element: WLF_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWLFSUPLSMBKDATA table
|
LAW2_S_USMM_PERS-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_USMM_PERS table
|
MAINTITMCSETXT_D-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITMCSETXT_D table
|
MAINTITMOBJLST_D-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITMOBJLST_D table
|
MAINTITMRSNTXT_D-CREATIONDATE table field - Date created
▼
Description: Date created Field Name: CREATIONDATE Data Element: TDFDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTITMRSNTXT_D table
|
MAINTNTFTECOBJ_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MAINTNTFTECOBJ_D table
|
MASSEKPOCONTRACT-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSEKPOCONTRACT table
|
MASSEKPOSCHAGREE-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSEKPOSCHAGREE table
|
MDGICUSTBPMULASN-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDGICUSTBPMULASN table
|
MDGISUPPBPMULASN-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDGISUPPBPMULASN table
|
MDO_SUBSCRIPTION-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: MDO_CREATIONDATE Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDO_SUBSCRIPTION table
|
MEIRCONDSUPLMNTX-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEIRCONDSUPLMNTX table
|
MEIRPRCGCONDRECX-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEIRPRCGCONDRECX table
|
MMPUR_EXT_S_EKKN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_S_EKKN table
|
MMPUR_EXT_S_EKKO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_S_EKKO table
|
MMPUR_PRINT_EKPO-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PRINT_EKPO table
|
MMPUR_SUPCONFH_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SUPCONFH_D table
|
MMPUR_S_CCTR_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_HDR table
|
MMPUR_S_CQTN_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CQTN_HDR table
|
MMPUR_S_CRFQ_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CRFQ_HDR table
|
MPES_EXEC_DEFECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_EXEC_DEFECT table
|
MRP_ACC_SHORTAGE-CREATIONDATE table field - System Date
▼
Description: System Date Field Name: CREATIONDATE Data Element: SYDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MRP_ACC_SHORTAGE table
|
NCHGRECREFMBOMTP-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NCHGRECREFMBOMTP table
|
OSPWMIME_HEADERS-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: OSPWDATE_TIME Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWMIME_HEADERS table
|
PAPITEMMIXEDACCT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAPITEMMIXEDACCT table
|
PARBSITMCUSTBANK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT_BF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARBSITMCUSTBANK table
|
PARITEMMIXEDACCT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARITEMMIXEDACCT table
|
PAVCSALESDOCITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PAVCSALESDOCITEM table
|
PBKPAYTLASTREFDT-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PBKPAYTLASTREFDT table
|
PCCACTTPCHGDOCIT-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCCACTTPCHGDOCIT table
|
PCNTRLCNTRPRCHIS-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLCNTRPRCHIS table
|
PCNTRLPRCHISTCMP-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLPRCHISTCMP table
|
PCOEBORDACTCSTG1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOEBORDACTCSTG1 table
|
PCOEBORDACTCSTG2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOEBORDACTCSTG2 table
|
PCOEBORDACTCSTG3-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOEBORDACTCSTG3 table
|
PCOEBORDACTCSTG4-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCOEBORDACTCSTG4 table
|
PCRMATLMOVAVGPRC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCRMATLMOVAVGPRC table
|
PCTRLGSETTLMTDOC-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCTRLGSETTLMTDOC table
|
PDAMAGEANALYCUBE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDAMAGEANALYCUBE table
|
PEBORDHIRTPRCST1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDHIRTPRCST1 table
|
PEBORDHIRTPRCST2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDHIRTPRCST2 table
|
PEBORDRTPRODCST1-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDRTPRODCST1 table
|
PEBORDRTPRODCST2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PEBORDRTPRODCST2 table
|
PFIAPGLACCLITSTG-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIAPGLACCLITSTG table
|
PFIAPGLACCTLITST-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIAPGLACCTLITST table
|
PFIGLACCTLITSTFA-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITSTFA table
|
PFIGLACCTLITSTGL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITSTGL table
|
PFIGLACCTLITSTUN-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIGLACCTLITSTUN table
|
PFIPRODCOSTBYORD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFIPRODCOSTBYORD table
|
PICLNEWOPNSUBCLM-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PICLNEWOPNSUBCLM table
|
PMAINTPLANSEARCH-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMAINTPLANSEARCH table
|
PMATOVERDUESITCA-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESITCA table
|
PMATOVERDUESITDT-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESITDT table
|
PMATOVERDUESITPB-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESITPB table
|
PMATOVERDUESITPC-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESITPC table
|
PMATOVERDUESITPD-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMATOVERDUESITPD table
|
PMEASURINGPTSRCH-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMEASURINGPTSRCH table
|
POAC_EKPO_BUFFER-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POAC_EKPO_BUFFER table
|
POBDELDITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POBDELDITMATTRIB table
|
PPLANTMRPPLNGCYC-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPLANTMRPPLNGCYC table
|
PPOITMCONVRTDAMT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITMCONVRTDAMT table
|
PPRCGCNDNRECDHDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRCGCNDNRECDHDR table
|
PPRDSTORLOCBASIC-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRDSTORLOCBASIC table
|
PPRJSCHMTLCMATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRJSCHMTLCMATTR table
|
PPROCORDMGMTCALC-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROCORDMGMTCALC table
|
PPROJFBUDGETSMRY-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROJFBUDGETSMRY table
|
PPURCONTRITMMNTR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCONTRITMMNTR table
|
PPURGPRCGCNDRECD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGPRCGCNDRECD table
|
PRETDELITMATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRETDELITMATTRIB table
|
PROD_PLNT_SLSTOR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_PLNT_SLSTOR table
|
PROD_S_STORAGE_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PROD_S_STORAGE_D table
|
PRSHPROJASGCDHDR-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRSHPROJASGCDHDR table
|
PRTWIPREPORTING4-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPREPORTING4 table
|
PRTWIPREPORTING5-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRTWIPREPORTING5 table
|
PSDSLSDOCSCHLAYS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSDSLSDOCSCHLAYS table
|
PSECDEPOPDATETME-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSECDEPOPDATETME table
|
PSLSPRCGCNDNRECD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSLSPRCGCNDNRECD table
|
PSRVCNFITMATTRIB-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRMS4_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSRVCNFITMATTRIB table
|
PSUCOCOPUORASGMT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSUCOCOPUORASGMT table
|
PURCTR_HDR_PRT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCTR_HDR_PRT_D table
|
PURORDACCR_DRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURORDACCR_DRAFT table
|
QLTYDELIVDOCITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYDELIVDOCITEM table
|
RBNKPAYMENTBATCH-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RBNKPAYMENTBATCH table
|
RECP_FDP_PARTNER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_PARTNER table
|
RECP_RECIPIENT_C-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_RECIPIENT_C table
|
RFM_POCONSRULE_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: POCONS_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFM_POCONSRULE_D table
|
RMMPURCHASEORDER-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMMPURCHASEORDER table
|
RMMPURCHASINGDOC-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMMPURCHASINGDOC table
|
SCHDGAGRMTPRTN_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCHDGAGRMTPRTN_D table
|
SCHEDGAGRMTHDR_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SCHEDGAGRMTHDR_D table
|
SHP_FDP_DELIVERY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SHP_FDP_DELIVERY table
|
TECHNICALOBJEC_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TECHNICALOBJEC_D table
|
VCH_HL_D_GRP_CST-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_HL_D_GRP_CST table
|
VFCLM_BM_BANKFEE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLM_BM_BANKFEE table
|
AOUTBDELIVERYITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AOUTBDELIVERYITEM table
|
ARETSDELIVERYITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARETSDELIVERYITEM table
|
CIM_S_HEADER_DATA-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIM_S_HEADER_DATA table
|
CMMOI_S_RO_OBJECT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMOI_S_RO_OBJECT table
|
CMM_S_ROBJ_BASE_H-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_BASE_H table
|
CRMS4S_IU_PRD_QRY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_QRY table
|
CSOFSLSORDQ_ODATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSOFSLSORDQ_ODATA table
|
EPM_TS_KPI_VALUES-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EPM_TS_KPI_VALUES table
|
FINCS_S_PIMPORTJE-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_PIMPORTJE table
|
FKKINV_FKKDOC_GFN-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_FKKDOC_GFN table
|
FKKINV_FKKDOC_GFN-CREATIONDATE table field - Date on which the record was createdDay On Which Accounting Document Was Entered
▼
Description: Date on which the record was createdDay On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_FKKDOC_GFN table
|
FPS_CATEGORY_FULL-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FPS_CATEGORY_FULL table
|
IDGT_S_HEADER_PUB-CREATIONDATE table field - Document Date
▼
Description: Document Date Field Name: CREATIONDATE Data Element: EIV_DOC_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDGT_S_HEADER_PUB table
|
ISBANKACCOUNTTP_D-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKACCOUNTTP_D table
|
ISBANKCONDITIONTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONTP table
|
ISCMMDTYRISKOBJTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYRISKOBJTP table
|
ISCOSTELEMENTTP_D-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTELEMENTTP_D table
|
ISFIXEDASSETTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFIXEDASSETTP_DR table
|
ISFUNDEDPROGRAMTP-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDEDPROGRAMTP table
|
ISFUNDSCENTERTP_D-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSCENTERTP_D table
|
ISINSPPLANPRTOPTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANPRTOPTP table
|
ISMAINTORDERTP_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTORDERTP_DR table
|
ISPAYMENTADVICETP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTADVICETP table
|
ISPURCHASEORDERTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEORDERTP table
|
ISQUALITYTASKTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_D table
|
ISRFQCOMPARETP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRFQCOMPARETP_DR table
|
ISSALESORDERTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSALESORDERTP_DR table
|
MMPUR_S_PO_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_HEADER table
|
MMPUR_S_PO_STATUS-CREATIONDATE table field - Purchase Order Date
▼
Description: Purchase Order Date Field Name: CREATIONDATE Data Element: BEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_STATUS table
|
MMPUR_S_PR_ITEMFC-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ITEMFC table
|
MMPUR_S_PR_STATUS-CREATIONDATE table field - Purchase Order Date
▼
Description: Purchase Order Date Field Name: CREATIONDATE Data Element: BEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_STATUS table
|
SDCI_ODATA_TEXT_S-CREATIONDATE table field - Field of type DATS
▼
Description: Field of type DATS Field Name: CREATIONDATE Data Element: DATS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDCI_ODATA_TEXT_S table
|
WRF_PCON_EKPO_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCON_EKPO_STY table
|
WRF_POTB_EKPO_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POTB_EKPO_STY table
|
AINBDELIVERYHEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINBDELIVERYHEADER table
|
ATP_BOP_ORDER_DATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATP_BOP_ORDER_DATA table
|
CRMS4S_IU_PRD_ATTR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_ATTR table
|
DFKK_RECO_PROP_GFN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_RECO_PROP_GFN table
|
FCLM_BAM_S_AMD_EXT-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_BAM_S_AMD_EXT table
|
FCOS_ACTIVITY_TYPE-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCOS_ACTIVITY_TYPE table
|
FKKBIX_UNIT_MD_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_UNIT_MD_GFN table
|
FKKINV_CA_COLL_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_CA_COLL_GFN table
|
FKKINV_UNIT_MD_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_MD_GFN table
|
FKKINV_UNIT_MD_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_MD_GFN table
|
FKK_VT_CHANGES_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_CHANGES_GFN table
|
FKK_VT_CHANGES_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_VT_CHANGES_GFN table
|
ISALLOCATIONTAGTP2-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: FCO_TAG_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCATIONTAGTP2 table
|
ISBANKACCOUNTTP_DR-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKACCOUNTTP_DR table
|
ISBUDGETDOCUMENTTP-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETDOCUMENTTP table
|
ISBUDGETENTRYDOCTP-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETENTRYDOCTP table
|
ISBUDGETPERIODTP_D-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETPERIODTP_D table
|
ISCOMMITMENTITEMTP-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMITMENTITEMTP table
|
ISCOSTELEMENTTP_DR-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTELEMENTTP_DR table
|
ISFUNDSCENTERTP_DR-CREATIONDATE table field - Funds Center Created on Date
▼
Description: Funds Center Created on Date Field Name: CREATIONDATE Data Element: FMIS_FC_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSCENTERTP_DR table
|
ISGLACCTINCOCODETP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCOCODETP table
|
ISINSPECTIONPLANTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP table
|
ISQUALITYTASKTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_DR table
|
ISREPETITIVECODETP-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISREPETITIVECODETP table
|
MDS_PPOS_ORDER_DYN-CREATIONDATE table field - PPO Order: Creation Date
▼
Description: PPO Order: Creation Date Field Name: CREATIONDATE Data Element: MDST_PPO_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDS_PPOS_ORDER_DYN table
|
MDS_PPOS_ORDER_HDR-CREATIONDATE table field - PPO Order: Creation Date
▼
Description: PPO Order: Creation Date Field Name: CREATIONDATE Data Element: MDST_PPO_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDS_PPOS_ORDER_HDR table
|
MMPUR_S_EXT_PR_HUB-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_PR_HUB table
|
MMPUR_S_PC_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PC_HDR_WFL table
|
MMPUR_S_PO_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_HDR_WFL table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_PR_HISTORY-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_HISTORY table
|
MMPUR_S_SA_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SA_HDR_WFL table
|
PMD_S_PRODUCT_ATTR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PRODUCT_ATTR table
|
REBP_PARTNER_RUSER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBP_PARTNER_RUSER table
|
RECP_FDP_RECIPIENT-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_RECIPIENT table
|
SDCMR_S_WFONEINBOX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDCMR_S_WFONEINBOX table
|
SDQUT_S_WFONEINBOX-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDQUT_S_WFONEINBOX table
|
SRA002_S_TIMEENTRY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CATS_ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SRA002_S_TIMEENTRY table
|
TSPURCHASEREQNITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM table
|
WRF_PPW_PPDART_STY-CREATIONDATE table field - Date of Hierarchy Determination
▼
Description: Date of Hierarchy Determination Field Name: CREATIONDATE Data Element: WRF_PPW_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PPW_PPDART_STY table
|
ACE_CHANGE_DOCUMENT-CREATIONDATE table field - Creation date of the change document
▼
Description: Creation date of the change document Field Name: CREATIONDATE Data Element: CDDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ACE_CHANGE_DOCUMENT table
|
AOUTBDELIVERYHEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AOUTBDELIVERYHEADER table
|
ARETSDELIVERYHEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARETSDELIVERYHEADER table
|
CRMS4S_EQUI_IL_ATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUI_IL_ATTR table
|
EPM_TS_NOTIFICATION-CREATIONDATE table field - Local Date
▼
Description: Local Date Field Name: CREATIONDATE Data Element: SYSTDATLO Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EPM_TS_NOTIFICATION table
|
FAC_S_GLACCT_SELOPT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_GLACCT_SELOPT table
|
FAC_S_WUPC_PCG_INFO-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_PCG_INFO table
|
FCOS_INTERNAL_ORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCOS_INTERNAL_ORDER table
|
FCO_MD_ACTIVITYTYPE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_MD_ACTIVITYTYPE table
|
FDP_QM_DEFECT_TASKS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT_TASKS table
|
FPS_DICTIONARY_FULL-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FPS_DICTIONARY_FULL table
|
ISABPPAYMENTBATCHTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISABPPAYMENTBATCHTP table
|
ISA_DSPLAY_DOCUMENT-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISA_DSPLAY_DOCUMENT table
|
ISBANKCONDITIONTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONTP_D table
|
ISBUDGETPERIODTP_DR-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETPERIODTP_DR table
|
ISBUSINESSPARTNERTP-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERTP table
|
ISBUSINESSPARTNERWD-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD table
|
ISCMMDTYRISKOBJTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYRISKOBJTP_D table
|
ISFUNDEDPROGRAMTP_D-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDEDPROGRAMTP_D table
|
ISGLACCOUNTINCOA_WD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOA_WD table
|
ISINSPPLANOPCHARCTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPCHARCTP table
|
ISINSPPLANPRTOPTP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANPRTOPTP_D table
|
ISMAINTENANCEITEMTP-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCEITEMTP table
|
ISMAINTENANCEPLANTP-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCEPLANTP table
|
ISMFGGDSMVTEXCPTNTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP table
|
ISPAYMENTADVICETP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTADVICETP_D table
|
ISPRODUCTPLANTMRPTP-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTPLANTMRPTP table
|
ISPURCHASEORDERTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEORDERTP_D table
|
ISPURGQUOTAARRGMTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGQUOTAARRGMTTP table
|
ISSALESORDERITEMTP1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSALESORDERITEMTP1 table
|
ISTECHNICALOBJECTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTECHNICALOBJECTTP table
|
LAW2_S_UI_USMM_PERS-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_UI_USMM_PERS table
|
MMPUR_DOCLST_SIITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_DOCLST_SIITEM table
|
MMPUR_PO_FOD_S_INFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_INFO table
|
MMPUR_PO_FOD_S_INFO-CREATIONDATE table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: CREATIONDATE Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_INFO table
|
MMPUR_SSP_REQN_ITEM-CREATIONDATE table field - 19 Characters
▼
Description: 19 Characters Field Name: CREATIONDATE Data Element: CHAR19 Data Type: CHAR length (Dec): 19(0) Check table: Conversion Routine: Domain Name: CHAR19 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SSP_REQN_ITEM table
|
MMPUR_S_CCTR_HEADER-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_HEADER table
|
MMPUR_S_CPO_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CPO_HDR_WFL table
|
MMPUR_S_DIST_OA_HDR-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_DIST_OA_HDR table
|
MMPUR_S_EXT_ACC_HUB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_ACC_HUB table
|
MMPUR_S_EXT_LOCALPR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALPR table
|
MMPUR_S_LCL_PO_DATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_LCL_PO_DATA table
|
MMPUR_S_PO_ITEM_ACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_ITEM_ACC table
|
MMPUR_S_PURCH_ORDER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCH_ORDER table
|
MMPUR_S_QTN_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_HDR_WFL table
|
MMPUR_S_RET_DEL_HDR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RET_DEL_HDR table
|
MMPUR_S_RET_DEL_ITM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RET_DEL_ITM table
|
MMPUR_S_RFQ_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RFQ_HDR_WFL table
|
MPESV_RTGP_WORKLIST-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPESV_RTGP_WORKLIST table
|
NGCS_CHARACTERISTIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CHARACTERISTIC table
|
POAC_PO_ITEM_BUFFER-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POAC_PO_ITEM_BUFFER table
|
BAPIEBDRREQUESTADMIN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIEBDRREQUESTADMIN table
|
CIMIC_HUB_S_INV_DEEP-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIMIC_HUB_S_INV_DEEP table
|
CMM_S_ROBJ_BASE_KOMK-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_BASE_KOMK table
|
DFKK_DISCO_PROPH_GFN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFKK_DISCO_PROPH_GFN table
|
EWASPURCHASEORDERPOS-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASPURCHASEORDERPOS table
|
FINCS_S_ODATA_IJE_WL-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_ODATA_IJE_WL table
|
ISALLOCATIONTAGTP2_D-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: FCO_TAG_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCATIONTAGTP2_D table
|
ISBANKCONDITIONTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONTP_DR table
|
ISBUDGETDOCUMENTTP_D-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETDOCUMENTTP_D table
|
ISBUDGETENTRYDOCTP_D-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETENTRYDOCTP_D table
|
ISBUDGETPERIODCORETP-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETPERIODCORETP table
|
ISBUSINESSPARTNERWD1-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD1 table
|
ISBUSINESSPARTNERWD5-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD5 table
|
ISCHFIEXCHARCALLOCTP-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHFIEXCHARCALLOCTP table
|
ISCOMMITMENTITEMTP_D-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMITMENTITEMTP_D table
|
ISFUNDEDPROGRAMTP_DR-CREATIONDATE table field - Funded Program Created on Date
▼
Description: Funded Program Created on Date Field Name: CREATIONDATE Data Element: FMIS_FP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDEDPROGRAMTP_DR table
|
ISGLACCOUNTINCOCD_WD-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOCD_WD table
|
ISGLACCTINCHTACCTSTP-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCHTACCTSTP table
|
ISGLACCTINCOCODETP_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCOCODETP_D table
|
ISINSPECTIONPLANTP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP_D table
|
ISINSPECTIONRESULTTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTTP table
|
ISINSPECTIONSUBSETTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP table
|
ISINSPPLANPRTOPTP_DR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANPRTOPTP_DR table
|
ISINSPSAMPLERESULTTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSAMPLERESULTTP table
|
ISPAYMENTADVICETP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYMENTADVICETP_DR table
|
ISPAYTFRMTCUSTTREETP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREETP table
|
ISPURCHASECONTRACTWD-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD table
|
ISPURCHASEORDERTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEORDERTP_DR table
|
ISREPETITIVECODETP_D-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISREPETITIVECODETP_D table
|
ISSCHEDGAGRMTPARTNWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTPARTNWD table
|
LAW2_S_USMM_PERS_BUF-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_USMM_PERS_BUF table
|
LOGEN_S_DELIVERY_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOGEN_S_DELIVERY_HDR table
|
LOIN_S_EXCISE_HEADER-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOIN_S_EXCISE_HEADER table
|
MMIM_GI_FOR_DELIVERY-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIM_GI_FOR_DELIVERY table
|
MMPUR_OA_S_UI_PURCTR-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OA_S_UI_PURCTR table
|
MMPUR_PR_S_PC_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PR_S_PC_HEADER table
|
MMPUR_S_CCTR_API_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_HDR table
|
MMPUR_S_CCTR_HDR_WFL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_HDR_WFL table
|
MMPUR_S_CONTRACT_HDR-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CONTRACT_HDR table
|
MMPUR_S_EXT_LOCALACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALACC table
|
MMPUR_S_PROCMTHUB_DN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_DN table
|
MMPUR_S_PROCMTHUB_GR-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_GR table
|
MMPUR_S_PROCMTHUB_PO-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_PO table
|
MMPUR_S_PURCHASE_SES-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASE_SES table
|
MMPUR_S_SSP_REQ_ITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_REQ_ITEM table
|
MMPUR_UI_CONTRACT_WL-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_UI_CONTRACT_WL table
|
PARTNER_CENTRAL_INFO-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PARTNER_CENTRAL_INFO table
|
QMS_INSPRESAGGR_CHAR-CREATIONDATE table field - Date on Which Data Record Was Created (Characteristic)
▼
Description: Date on Which Data Record Was Created (Characteristic) Field Name: CREATIONDATE Data Element: QMS_INSPRESAGGR_DATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMS_INSPRESAGGR_CHAR table
|
RECP_PARTNER_SPEC1_C-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_PARTNER_SPEC1_C table
|
RECP_PARTNER_SPEC2_C-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_PARTNER_SPEC2_C table
|
REMOB_BROKER_PARTNER-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REMOB_BROKER_PARTNER table
|
TDS_BD_DELIVERY_HEAD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_DELIVERY_HEAD table
|
TDS_BD_DELIVERY_ITEM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_BD_DELIVERY_ITEM table
|
TSPURCHASEREQNITEM_D-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_D table
|
VLC_VEHICLEINVOICE_S-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VLC_VEHICLEINVOICE_S table
|
/CPD/S_SC_EMPPROJHIST-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /CPD/S_SC_EMPPROJHIST table
|
/PM0/ABD_CHIP_BP_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/ABD_CHIP_BP_DATA table
|
/SAPAPO/REMARK_QP_ALL-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /SCMB/CREDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/REMARK_QP_ALL table
|
/SAPPO/BAPI_ORDER_HDR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BAPI_ORDER_HDR table
|
/SAPPO/BAPI_STR_ORDER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BAPI_STR_ORDER table
|
/SAPPO/STR_ORDER_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_ORDER_DATA table
|
/STTPEC/S_TRN_PO_ITEM-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /STTPEC/S_TRN_PO_ITEM table
|
CMD_PRD_S_RFC_PACKAGE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_RFC_PACKAGE table
|
CMM_S_ROBJ_HEADER_INT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_HEADER_INT table
|
CRMS4S_FUNLOC_IL_ATTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_FUNLOC_IL_ATTR table
|
CRMS4S_IU_PRD_BL_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_IU_PRD_BL_DATA table
|
CRMST_EMP_OBJECT_BUIL-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMST_EMP_OBJECT_BUIL table
|
EAMS_S_NAV_PR_ID_ATTR-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_NAV_PR_ID_ATTR table
|
FAA_IS_S_MD_ROOT_DATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAA_IS_S_MD_ROOT_DATA table
|
FINCS_S_JE_ITEM_DRAFT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_JE_ITEM_DRAFT table
|
FKC_FDP_ACC_BLNC_ITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKC_FDP_ACC_BLNC_ITEM table
|
IBKK_STAT_TRN_OVR_INT-CREATIONDATE table field - Creation Date of the Data Medium
▼
Description: Creation Date of the Data Medium Field Name: CREATIONDATE Data Element: BKK_CRDATD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBKK_STAT_TRN_OVR_INT table
|
ISABPPAYMENTBATCHTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISABPPAYMENTBATCHTP_D table
|
ISALLOCATIONTAGTP2_DR-CREATIONDATE table field - Created on
▼
Description: Created on Field Name: CREATIONDATE Data Element: FCO_TAG_CREATED_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISALLOCATIONTAGTP2_DR table
|
ISAPPLICATIONOFFUNDTP-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAPPLICATIONOFFUNDTP table
|
ISBANKCONDITIONITEMTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONITEMTP table
|
ISBUDGETDOCUMENTTP_DR-CREATIONDATE table field - Creation Date for Document
▼
Description: Creation Date for Document Field Name: CREATIONDATE Data Element: BDGT_DOCCRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETDOCUMENTTP_DR table
|
ISBUDGETENTRYDOCTP_DR-CREATIONDATE table field - Date on which the object was created or updated
▼
Description: Date on which the object was created or updated Field Name: CREATIONDATE Data Element: BUKU_CRTDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETENTRYDOCTP_DR table
|
ISBUSINESSPARTNERTP_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERTP_D table
|
ISBUSINESSPARTNERWD_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD_D table
|
ISCADISPUTEDCREDITTP3-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDCREDITTP3 table
|
ISCNSLDTNJRNLENTRYTP1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNSLDTNJRNLENTRYTP1 table
|
ISCOMMITMENTITEMTP_DR-CREATIONDATE table field - FIFM: Entry Date
▼
Description: FIFM: Entry Date Field Name: CREATIONDATE Data Element: FM_ERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOMMITMENTITEMTP_DR table
|
ISCONFIGNCHARCGROUPTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONFIGNCHARCGROUPTP table
|
ISGLACCOUNTINCOA_WD_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOA_WD_D table
|
ISGLACCTINCOCODETP_DR-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCOCODETP_DR table
|
ISINSPECTIONPLANTP_DR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP_DR table
|
ISINSPECTIONSUBSETTP2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP2 table
|
ISINSPPLANOPCHARCTP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPCHARCTP_D table
|
ISINSPPLANOPERATIONTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPERATIONTP table
|
ISMAINTENANCEITEMTP_D-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCEITEMTP_D table
|
ISMAINTENANCEPLANTP_D-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCEPLANTP_D table
|
ISMAINTNOTIFICATIONTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP table
|
ISMFGGDSMVTEXCPTNTP_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_D table
|
ISPRODUCTPLANTMRPTP_D-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTPLANTMRPTP_D table
|
ISPUBLICSECTORNOTETP2-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2 table
|
ISPURCHASECONTRACTWD1-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD1 table
|
ISPURCHASECONTRACTWD2-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD2 table
|
ISPURGQUOTAARRGMTTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGQUOTAARRGMTTP_D table
|
ISREPETITIVECODETP_DR-CREATIONDATE table field - Transaction Date
▼
Description: Transaction Date Field Name: CREATIONDATE Data Element: FQM_TRANSACTION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: FQM_DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISREPETITIVECODETP_DR table
|
ISSALESORDERITEMTP1_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSALESORDERITEMTP1_D table
|
ISSUPLRQUOTATIONENHWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONENHWD table
|
ISTECHNICALOBJECTTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTECHNICALOBJECTTP_D table
|
ISUTILITIESNEWFRAUDTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP table
|
LAW2_S_USMM_PERS_DATA-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_USMM_PERS_DATA table
|
LOIN_S_SUBCON_CHALLAN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOIN_S_SUBCON_CHALLAN table
|
MMPUR_PO_FOD_S_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_HEADER table
|
MMPUR_REQ_S_PR_STATUS-CREATIONDATE table field - Purchase Order Date
▼
Description: Purchase Order Date Field Name: CREATIONDATE Data Element: BEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_REQ_S_PR_STATUS table
|
MMPUR_S_CCTR_API_DATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_DATA table
|
MMPUR_S_CNTRLPURCONTR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CNTRLPURCONTR table
|
MMPUR_S_FOD_DN_DETAIL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_DN_DETAIL table
|
MMPUR_S_FOD_GR_DETAIL-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_GR_DETAIL table
|
MMPUR_S_FOD_PO_DETAIL-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_PO_DETAIL table
|
MMPUR_S_FOD_SA_DETAIL-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_SA_DETAIL table
|
MMPUR_S_GOODS_RECIEPT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_GOODS_RECIEPT table
|
MMPUR_S_GOOD_RECEIPTS-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_GOOD_RECEIPTS table
|
MMPUR_S_PROCMTHUB_CTR-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_CTR table
|
MMPUR_S_PROCMTHUB_RFQ-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_RFQ table
|
MMPUR_S_PROCMTHUB_SES-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_SES table
|
MMPUR_S_PSA_BASICDATA-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PSA_BASICDATA table
|
MMPUR_S_PURCHASEORDER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASEORDER table
|
MMPUR_S_QTN_ODATA_API-CREATIONDATE table field - Character field of length 40
▼
Description: Character field of length 40 Field Name: CREATIONDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_ODATA_API table
|
MMPUR_S_QTN_RAW_ODATA-CREATIONDATE table field - Character field of length 40
▼
Description: Character field of length 40 Field Name: CREATIONDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_QTN_RAW_ODATA table
|
MMPUR_S_RFQ_ODATA_API-CREATIONDATE table field - Character field of length 40
▼
Description: Character field of length 40 Field Name: CREATIONDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RFQ_ODATA_API table
|
MMPUR_S_RFQ_RAW_ODATA-CREATIONDATE table field - Character field of length 40
▼
Description: Character field of length 40 Field Name: CREATIONDATE Data Element: CHAR40 Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: CHAR40 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_RFQ_RAW_ODATA table
|
MMPUR_S_SAG_ODATA_API-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SAG_ODATA_API table
|
MMPUR_S_SAG_RAW_ODATA-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SAG_RAW_ODATA table
|
MMPUR_S_SA_HDR_IMPORT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SA_HDR_IMPORT table
|
MMPUR_S_SSP_PR_HEADER-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_HEADER table
|
QINSP_PLAN_CHARACT_CB-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSP_PLAN_CHARACT_CB table
|
REBP_PARTNER_COMPLETE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBP_PARTNER_COMPLETE table
|
TSPURCHASEREQNITEM_DR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_DR table
|
/PM0/PPO_DIALOG_SELECT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PM0/PPO_DIALOG_SELECT table
|
/SAPAPO/REMARK_QP_DISP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /SCMB/CREDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/REMARK_QP_DISP table
|
/SAPPO/TYP_F_GUI_CLOSE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/TYP_F_GUI_CLOSE table
|
/SYCLO/MM_PO_ITEMS_STR-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/MM_PO_ITEMS_STR table
|
ARBERP_S_C_QTEQOUT_RFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARBERP_S_C_QTEQOUT_RFQ table
|
BBP_ES_S_C_QTEQOUT_RFQ-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BBP_ES_S_C_QTEQOUT_RFQ table
|
CIMIC_HUB_S_INV_HEADER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIMIC_HUB_S_INV_HEADER table
|
CMD_PRD_S_PRODUCT_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_PRODUCT_DATA table
|
CRMS4S_FUNLOC_IL_ADVQS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_FUNLOC_IL_ADVQS table
|
FAC_S_JRNLENTRYHISTORY-CREATIONDATE table field - Journal Entry Creation Date
▼
Description: Journal Entry Creation Date Field Name: CREATIONDATE Data Element: FIS_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_JRNLENTRYHISTORY table
|
FAC_S_PRFCTR_CHANGELOG-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_PRFCTR_CHANGELOG table
|
FAC_S_WUPC_SOITEM_INFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_SOITEM_INFO table
|
FCLM_S_ACCOUNT_STAGING-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_S_ACCOUNT_STAGING table
|
FINCS_S_INDEX_JE_DRAFT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_INDEX_JE_DRAFT table
|
FINS_CFIN_EX_AV_CI_AIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_CI_AIF table
|
FINS_CFIN_EX_AV_PO_AIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_PO_AIF table
|
FINS_CFIN_EX_AV_SI_AIF-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_SI_AIF table
|
FINS_CFIN_EX_AV_SO_AIF-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_EX_AV_SO_AIF table
|
FIN_API_AT_DEEP_ENTITY-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIN_API_AT_DEEP_ENTITY table
|
ISABPPAYMENTBATCHTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISABPPAYMENTBATCHTP_DR table
|
ISBUDGETPERIODCORETP_D-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETPERIODCORETP_D table
|
ISBUSINESSPARTNERTP_DR-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERTP_DR table
|
ISBUSINESSPARTNERWD1_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD1_D table
|
ISBUSINESSPARTNERWD5_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSINESSPARTNERWD5_D table
|
ISCADISPUTEDPAYMENTTP3-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDPAYMENTTP3 table
|
ISCAINVCGCLRFCTNCASETP-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP table
|
ISCHFIEXCHARCALLOCTP_D-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHFIEXCHARCALLOCTP_D table
|
ISCOSTELEMENTWITHDRAFT-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTELEMENTWITHDRAFT table
|
ISGLACCOUNTINCOCD_WD_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOCD_WD_D table
|
ISGLACCTINCHTACCTSTP_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCHTACCTSTP_D table
|
ISINSPECTIONRESULTTP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTTP_D table
|
ISINSPECTIONSUBSETTP_2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_2 table
|
ISINSPECTIONSUBSETTP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_D table
|
ISINSPPLANOPCHARCTP_DR-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPCHARCTP_DR table
|
ISINSPSAMPLERESULTTP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSAMPLERESULTTP_D table
|
ISMFGGDSMVTEXCPTNTP_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGDSMVTEXCPTNTP_DR table
|
ISPAYTFRMTCUSTTREETP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREETP_D table
|
ISPRODUCTPLANTMRPTP_DR-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTPLANTMRPTP_DR table
|
ISPURCHASECONTRACTWD_D-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD_D table
|
ISPURGQUOTAARRGMTTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGQUOTAARRGMTTP_DR table
|
ISSALESORDERITEMTP1_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSALESORDERITEMTP1_DR table
|
ISSCHDEGAGRMTPARTNERWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHDEGAGRMTPARTNERWD table
|
ISSCHEDGAGRMTPARTNERWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTPARTNERWD table
|
ISSCHEDGAGRMTPARTNWD_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTPARTNWD_D table
|
ISTECHNICALOBJECTTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISTECHNICALOBJECTTP_DR table
|
ISUTILITIESNEWFRAUDTP1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP1 table
|
ISUTILITIESNEWFRAUDTP2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP2 table
|
ISUTILITIESNEWFRAUDTP3-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP3 table
|
LAW2_S_UI_USMM_PERS_IS-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_UI_USMM_PERS_IS table
|
LAW2_S_USMM_PERS_DATAS-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_USMM_PERS_DATAS table
|
MMPUR_CENTRAL_SOURCING-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_SOURCING table
|
MMPUR_CENTRAL_SOURCING-CREATIONDATE table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: CREATIONDATE Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_SOURCING table
|
MMPUR_PO_FOD_S_HEADERX-CREATIONDATE table field - Boolean Variable (X = True, - = False, Space = Unknown)
▼
Description: Boolean Variable (X = True, - = False, Space = Unknown) Field Name: CREATIONDATE Data Element: BOOLEAN Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BOOLEAN MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_FOD_S_HEADERX table
|
MMPUR_S_CCTR_API_INPUT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_INPUT table
|
MMPUR_S_CTR_HDR_IMPORT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CTR_HDR_IMPORT table
|
MMPUR_S_FOD_RFQ_DETAIL-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_RFQ_DETAIL table
|
MMPUR_S_FOD_SES_DETAIL-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_SES_DETAIL table
|
MMPUR_S_PROCMTHUB_CCTR-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_CCTR table
|
MMPUR_S_PROCMTHUB_CRFQ-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_CRFQ table
|
MMPUR_S_PR_ITEM_IMPORT-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ITEM_IMPORT table
|
MMPUR_S_PR_RPL_DETAILS-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_RPL_DETAILS table
|
MMPUR_S_PURCHASE_ORDER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASE_ORDER table
|
MMPUR_S_SSP_PR_HISTORY-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_HISTORY table
|
MMPUR_S_SSP_PR_HISTORY-CREATIONDATE table field - Purchase Order Date
▼
Description: Purchase Order Date Field Name: CREATIONDATE Data Element: BEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_HISTORY table
|
MMPUR_S_SSP_PR_HISTORY-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_HISTORY table
|
NGCS_CORE_CHARC_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CORE_CHARC_HEADER table
|
RECP_FDP_PARTNER_SPEC1-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_PARTNER_SPEC1 table
|
RECP_FDP_PARTNER_SPEC2-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RECP_FDP_PARTNER_SPEC2 table
|
SDAVC_TS_RESOURCE_DATA-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDAVC_TS_RESOURCE_DATA table
|
SEPMRA_S_ISALESORDERTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRA_S_ISALESORDERTP table
|
WRF_PCON_DATA_EKPO_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCON_DATA_EKPO_STY table
|
WRF_POHF_DATA_EKPO_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_EKPO_STY table
|
WRF_PPW_PPDART_CHG_STY-CREATIONDATE table field - Date of Hierarchy Determination
▼
Description: Date of Hierarchy Determination Field Name: CREATIONDATE Data Element: WRF_PPW_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PPW_PPDART_CHG_STY table
|
/ISDFPS/EBAN_MAT_PRPL_S-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/EBAN_MAT_PRPL_S table
|
/PLMI/S_CSTRT_DATA_BOBF-CREATIONDATE table field - Date of Creation
▼
Description: Date of Creation Field Name: CREATIONDATE Data Element: /PLMB/CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/S_CSTRT_DATA_BOBF table
|
/SAPPO/STR_ORDER_DETAIL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_ORDER_DETAIL table
|
CMD_MIG_PRD_S_PROD_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_MIG_PRD_S_PROD_DATA table
|
CMD_PRD_S_RFC_PACKAGE_2-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_RFC_PACKAGE_2 table
|
CRMS4S_CONDITION_RECORD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_CONDITION_RECORD table
|
CRMS4S_EQUIPMENT_SEARCH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUIPMENT_SEARCH table
|
CRMS4S_FUNLOC_IL_RESULT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_FUNLOC_IL_RESULT table
|
FAC_S_WUPC_PROJECT_INFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_PROJECT_INFO table
|
FAP_MPM_S_PAYTMEDIAITEM-CREATIONDATE table field - Payment Media Creation Date
▼
Description: Payment Media Creation Date Field Name: CREATIONDATE Data Element: FARP_TSDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAP_MPM_S_PAYTMEDIAITEM table
|
FCLM_BAM_ACCOUNT_HEADER-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_BAM_ACCOUNT_HEADER table
|
FINCS_S_JRNLENTR_ITEM_C-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_JRNLENTR_ITEM_C table
|
FIN_FO_BLNC_CHKL_HEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIN_FO_BLNC_CHKL_HEADER table
|
FKK_HEADER_IN_OPEN_ITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKK_HEADER_IN_OPEN_ITEM table
|
ISAPPLICATIONOFFUNDTP_D-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAPPLICATIONOFFUNDTP_D table
|
ISBANKCONDITIONITEMTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONITEMTP_D table
|
ISBUDGETPERIODCORETP_DR-CREATIONDATE table field - Budget Period Created on Date
▼
Description: Budget Period Created on Date Field Name: CREATIONDATE Data Element: FMIS_BPD_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUDGETPERIODCORETP_DR table
|
ISCADISPUTEDCREDITTP3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDCREDITTP3_D table
|
ISCADISPUTEDDOCUMENTTP3-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDDOCUMENTTP3 table
|
ISCHFIEXCHARCALLOCTP_DR-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHFIEXCHARCALLOCTP_DR table
|
ISCNDNCONTRCLMREQITEMTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQITEMTP table
|
ISCNDNCONTRCLMREQPARTTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQPARTTP table
|
ISCNSLDTNJRNLENTRYTP1_D-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNSLDTNJRNLENTRYTP1_D table
|
ISCONFIGNCHARCGROUPTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONFIGNCHARCGROUPTP_D table
|
ISGLACCTINCHTACCTSTP_DR-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCHTACCTSTP_DR table
|
ISINSPECTIONSUBSETTP2_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP2_D table
|
ISINSPECTIONSUBSETTP_DR-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_DR table
|
ISINSPPLANOPERATIONTP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPERATIONTP_D table
|
ISMAINTENANCETASKLISTTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCETASKLISTTP table
|
ISMAINTNOTIFICATIONTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP_D table
|
ISPAYTFRMTCUSTTREETP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPAYTFRMTCUSTTREETP_DR table
|
ISPREPAYMENTAGREEMENTTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTAGREEMENTTP table
|
ISPUBLICSECTORNOTETP2_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_D table
|
ISPURCHASECONTRACTWD1_D-CREATIONDATE table field - Purchasing Document Date
▼
Description: Purchasing Document Date Field Name: CREATIONDATE Data Element: EBDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD1_D table
|
ISPURCHASECONTRACTWD2_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD2_D table
|
ISPURCHASECONTRACTWD_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTWD_DR table
|
ISSCHEDGAGRMTPARTNWD_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTPARTNWD_DR table
|
ISSCHEDULEAGMTWITHDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDULEAGMTWITHDRAFT table
|
ISSUPLRQUOTATIONENHWD_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONENHWD_D table
|
ISUTILITIESNEWFRAUDTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP_D table
|
MMPUR_A_CCTRVERSIONHIST-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_A_CCTRVERSIONHIST table
|
MMPUR_OUTLINE_AGRMT_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_AGRMT_HDR table
|
MMPUR_PREQUISITION_ITEM-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ITEM table
|
MMPUR_S_CCTR_API_OUTPUT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_OUTPUT table
|
MMPUR_S_CCTR_HDR_IMPORT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_HDR_IMPORT table
|
MMPUR_S_OUTL_AGRMNT_HDR-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_OUTL_AGRMNT_HDR table
|
OSPWCONTENT_DISPOSITION-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: OSPWDATE_TIME Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWCONTENT_DISPOSITION table
|
OSPWDELETE_EMAIL_IN_DOC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: OSPWDATE_TIME Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWDELETE_EMAIL_IN_DOC table
|
RFM_TS_IALIGNAASLPURITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFM_TS_IALIGNAASLPURITM table
|
/SAPPO/STR_DIALOG_SELECT-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_DIALOG_SELECT table
|
/SAPPO/STR_DYN_ORDER_HDR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_DYN_ORDER_HDR table
|
ATP_BOP_VARIANT_SHLP_EXT-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: ATP_BOP_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ATP_BOP_VARIANT_SHLP_EXT table
|
BAPIBUS1006_CENTRAL_INFO-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIBUS1006_CENTRAL_INFO table
|
BAPI_IBKK_STAT_TURN_OVER-CREATIONDATE table field - Creation Date of the Data Medium
▼
Description: Creation Date of the Data Medium Field Name: CREATIONDATE Data Element: BAPI_BKK_DTE_CREATION_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_IBKK_STAT_TURN_OVER table
|
BAPI_S_SEPA_MANDATE_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_S_SEPA_MANDATE_DATA table
|
BBPS_ER_EXT_PURCHASE_REQ-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BBPS_ER_EXT_PURCHASE_REQ table
|
BUS_EI_BUPA_SEPA_MANDATE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_BUPA_SEPA_MANDATE table
|
BUS_EI_BUPA_SEPA_MANDATE-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_BUPA_SEPA_MANDATE table
|
BUS_EI_SEPA_MANDATE_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_SEPA_MANDATE_DATA table
|
CIMIC_HUB_S_INV_HEADER_P-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIMIC_HUB_S_INV_HEADER_P table
|
CMD_PRD_S_PLANT_MRP_DATA-CREATIONDATE table field - To date of the material to be copied for consumption
▼
Description: To date of the material to be copied for consumption Field Name: CREATIONDATE Data Element: VRBDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_PLANT_MRP_DATA table
|
CMM_S_ROBJ_BASE_COMPLETE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_BASE_COMPLETE table
|
CRMS4S_EQUI_IL_ADVSEARCH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUI_IL_ADVSEARCH table
|
CRMST_HEADER_OBJECT_BUIL-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMST_HEADER_OBJECT_BUIL table
|
CSPRODUCTSTORAGELOCATION-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSPRODUCTSTORAGELOCATION table
|
EISU_IL_AMI_EVENT_RESULT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EISU_IL_AMI_EVENT_RESULT table
|
FAC_S_GLACCTINCOCODE_DSF-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_GLACCTINCOCODE_DSF table
|
FAC_S_WUPC_PCG_HIERARCHY-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_WUPC_PCG_HIERARCHY table
|
FKC_FDP_BLNC_NOTF_HEADER-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: COCDT_KK Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: SYDATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKC_FDP_BLNC_NOTF_HEADER table
|
ISAPPLICATIONOFFUNDTP_DR-CREATIONDATE table field - Application of Funds Created on Date
▼
Description: Application of Funds Created on Date Field Name: CREATIONDATE Data Element: FMIS_AOF_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISAPPLICATIONOFFUNDTP_DR table
|
ISBANKCONDITIONITEMTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: BKK_CRDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBANKCONDITIONITEMTP_DR table
|
ISCADISPUTEDCREDITTP3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDCREDITTP3_DR table
|
ISCADISPUTEDPAYMENTTP3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDPAYMENTTP3_D table
|
ISCAINVCGCLRFCTNCASETP_D-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_D table
|
ISCENTRALPURCHASEORDERTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASEORDERTP table
|
ISCNSLDTNJRNLENTRYTP1_DR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNSLDTNJRNLENTRYTP1_DR table
|
ISCONFIGNCHARCGROUPTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONFIGNCHARCGROUPTP_DR table
|
ISCOSTELEMENTWITHDRAFT_D-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTELEMENTWITHDRAFT_D table
|
ISINSPECTIONSUBSETTP_2_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_2_D table
|
ISINSPPLANDPNDANTCHARCTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANDPNDANTCHARCTP table
|
ISINSPPLANOPERATIONTP_DR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANOPERATIONTP_DR table
|
ISMAINTNOTIFICATIONTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTNOTIFICATIONTP_DR table
|
ISPRODALLOCATIONOBJECTTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCATIONOBJECTTP table
|
ISPUBLICSECTORNOTETP2_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORNOTETP2_DR table
|
ISPURCHASEREQUISITION_WD-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITION_WD table
|
ISPURCTRPARTNERWITHDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERWITHDRAFT table
|
ISPURREQNITMSOPENFORCONF-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNITMSOPENFORCONF table
|
ISQLTYFIRSTARTICLEINSPTP-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQLTYFIRSTARTICLEINSPTP table
|
ISQUALITYINPROCUREMENTTP-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP table
|
ISRUNOVERHEADSTATISTICTP-CREATIONDATE table field - Date Overhead document was created
▼
Description: Date Overhead document was created Field Name: CREATIONDATE Data Element: FCO_OVHD_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNOVERHEADSTATISTICTP table
|
ISSCHDEGAGRMTPARTNERWD_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHDEGAGRMTPARTNERWD_D table
|
ISSCHEDGAGRMTPARTNERWD_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTPARTNERWD_D table
|
ISSCHEDULEAGMTWITHDRAFT1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDULEAGMTWITHDRAFT1 table
|
ISSUPLRQUOTATIONENHWD_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLRQUOTATIONENHWD_DR table
|
ISUTILITIESNEWFRAUDTP1_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP1_D table
|
ISUTILITIESNEWFRAUDTP2_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP2_D table
|
ISUTILITIESNEWFRAUDTP3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP3_D table
|
ISUTILITIESNEWFRAUDTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP_DR table
|
MMIM_GI_FOR_DELIVERY_CNL-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIM_GI_FOR_DELIVERY_CNL table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_CENTRAL_PURCHASING-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
MMPUR_OUTLINE_AGRMT_HDRX-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_AGRMT_HDRX table
|
MMPUR_OUTLINE_MEOUT_EXKN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUT_EXKN table
|
MMPUR_PREQUISITION_ITEMX-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ITEMX table
|
MMPUR_S_CENTRAL_CONTRACT-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CENTRAL_CONTRACT table
|
MMPUR_S_EXTR_PR_DATA_HUB-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_PR_DATA_HUB table
|
MMPUR_S_LCL_PO_ITEM_ACCT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_LCL_PO_ITEM_ACCT table
|
MMPUR_S_PO_BUSINESS_FLOW-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_BUSINESS_FLOW table
|
MMPUR_S_PO_BUSINESS_FLOW-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_BUSINESS_FLOW table
|
MMPUR_S_PO_BUSINESS_FLOW-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_BUSINESS_FLOW table
|
MMPUR_S_PO_BUSINESS_FLOW-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_BUSINESS_FLOW table
|
MMPUR_S_PO_BUSINESS_FLOW-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
MMPUR_S_PR_BUSINESS_FLOW-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_BUSINESS_FLOW table
|
PMD_S_PRD_PLANT_SL_STORE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMD_S_PRD_PLANT_SL_STORE table
|
SDAVC_TS_VERSION_DATA_UI-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDAVC_TS_VERSION_DATA_UI table
|
SDBIL_EBDR_REQUEST_ADMIN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDBIL_EBDR_REQUEST_ADMIN table
|
SHP_S_COLLECTIVE_RUN_LOG-CREATIONDATE table field - Delivery Log Creation Date
▼
Description: Delivery Log Creation Date Field Name: CREATIONDATE Data Element: LOG_CREATE_DATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SHP_S_COLLECTIVE_RUN_LOG table
|
TSPURCHASEREQNACCTASSGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT table
|
/SAPPO/BADI_STR_ORDER_HDR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BADI_STR_ORDER_HDR table
|
/SAPPO/STR_ORDER_HDR_AUTH-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_ORDER_HDR_AUTH table
|
CMM_S_CD_RO_BASE_COMPLETE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CD_RO_BASE_COMPLETE table
|
FAC_S_COSTELEMENTLISTITEM-CREATIONDATE table field - Entered On
▼
Description: Entered On Field Name: CREATIONDATE Data Element: ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_COSTELEMENTLISTITEM table
|
FCLM_S_ACCOUNT_STAGING_GL-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_S_ACCOUNT_STAGING_GL table
|
FCO_COST_GLOBAL_ACCT_HIER-CREATIONDATE table field - Version Creation Date
▼
Description: Version Creation Date Field Name: CREATIONDATE Data Element: VRSCD Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_COST_GLOBAL_ACCT_HIER table
|
FINCS_S_JRNLENTR_HEADER_C-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINCS_S_JRNLENTR_HEADER_C table
|
FINS_CFIN_S_AV_SO_EX_ITEM-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_ITEM table
|
FRM_GR_EKPO_EXTENDED_TYPE-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FRM_GR_EKPO_EXTENDED_TYPE table
|
ISBUSPARTRELATIONSHIPTP_2-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSPARTRELATIONSHIPTP_2 table
|
ISCADISPUTEDDOCUMENTTP3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDDOCUMENTTP3_D table
|
ISCADISPUTEDPAYMENTTP3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDPAYMENTTP3_DR table
|
ISCAINVCGCLRFCTNCASETP_DR-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCAINVCGCLRFCTNCASETP_DR table
|
ISCASECURITYDEPOSITMGMTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCASECURITYDEPOSITMGMTTP table
|
ISCNDNCONTRCLMREQITEMTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQITEMTP_D table
|
ISCNDNCONTRCLMREQPARTTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQPARTTP_D table
|
ISCNSLDTNJRNLENTRYITEMTP1-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNSLDTNJRNLENTRYITEMTP1 table
|
ISGLACCOUNTINCOAWITHDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOAWITHDRAFT table
|
ISGLACCTINCOCODEWITHDRAFT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCOCODEWITHDRAFT table
|
ISINSPECTIONRESULTVALUETP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTVALUETP table
|
ISINSPSUBSETRESULTVALUETP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSUBSETRESULTVALUETP table
|
ISMAINTENANCEITEMTP_D_EXT-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCEITEMTP_D_EXT table
|
ISMAINTENANCEPLANTP_D_EXT-CREATIONDATE table field - Date of creation
▼
Description: Date of creation Field Name: CREATIONDATE Data Element: EDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCEPLANTP_D_EXT table
|
ISMAINTENANCETASKLISTTP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTENANCETASKLISTTP_D table
|
ISPREPAYMENTAGREEMENTTP_D-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTAGREEMENTTP_D table
|
ISPURCTRPARTNERSWITHDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT table
|
ISSCHEDGAGRMTHDRWITHDRAFT-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTHDRWITHDRAFT table
|
ISSCHEDGAGRMTPARTNERWD_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTPARTNERWD_DR table
|
ISSCHEDULEAGMTWITHDRAFT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDULEAGMTWITHDRAFT_D table
|
ISUTILITIESNEWFRAUDTP1_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP1_DR table
|
ISUTILITIESNEWFRAUDTP2_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP2_DR table
|
ISUTILITIESNEWFRAUDTP3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUTILITIESNEWFRAUDTP3_DR table
|
LAW2_S_USMM_USER_PER_PART-CREATIONDATE table field - Creation Date of the User Master Record
▼
Description: Creation Date of the User Master Record Field Name: CREATIONDATE Data Element: XUERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LAW2_S_USMM_USER_PER_PART table
|
LOIN_S_MONTHLYUTILIZATION-CREATIONDATE table field - Excise Document Entry Date
▼
Description: Excise Document Entry Date Field Name: CREATIONDATE Data Element: J_1ICPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOIN_S_MONTHLYUTILIZATION table
|
MMPUR_S_EXTR_LOCALPR_DATA-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_LOCALPR_DATA table
|
MMPUR_S_EXT_LCL_PO_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LCL_PO_HEADER table
|
MMPUR_S_PURCH_REQUISITION-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCH_REQUISITION table
|
MMPUR_S_PUR_GOODS_RECIEPT-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PUR_GOODS_RECIEPT table
|
NGCS_CLASS_CHARACTERISTIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CLASS_CHARACTERISTIC table
|
OSPWMAINTAIN_EMAIL_IN_DOC-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: OSPWDATE_TIME Data Type: STRU length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OSPWMAINTAIN_EMAIL_IN_DOC table
|
SDCMR_S_WFONEINBOX_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDCMR_S_WFONEINBOX_HEADER table
|
SDQUT_S_WFONEINBOX_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDQUT_S_WFONEINBOX_HEADER table
|
SEPMRA_S_ISALESORDERTP1_D-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRA_S_ISALESORDERTP1_D table
|
SEPMRA_S_ISALESORDERTP_DR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPMRA_S_ISALESORDERTP_DR table
|
VCH_HL_S_GROUP_IN_PROFILE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VCH_HL_S_GROUP_IN_PROFILE table
|
WRF_PCON_DATA_AC_COSI_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCON_DATA_AC_COSI_STY table
|
WRF_PCTR_PO_DOC_ITEMS_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCTR_PO_DOC_ITEMS_STY table
|
WRF_POHF_DATA_AC_POSI_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSI_STY table
|
/SAPPO/BADI_STR_ORDER_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BADI_STR_ORDER_DATA table
|
/SAPPO/BAPI_STR_ORDER_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BAPI_STR_ORDER_DATA table
|
BAPIBUS1006_SEPA_MANDATE_X-CREATIONDATE table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: CREATIONDATE Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIBUS1006_SEPA_MANDATE_X table
|
CRMS4S_EQUI_IL_ATTR_BUFFER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUI_IL_ATTR_BUFFER table
|
CRMS4S_FUNCTIONAL_LOCATION-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: ICRDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_FUNCTIONAL_LOCATION table
|
CSPRODUCTSTORAGELOCATION_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSPRODUCTSTORAGELOCATION_D table
|
FAC_S_GLACCTINCHTACCTS_DSF-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_GLACCTINCHTACCTS_DSF table
|
FAC_S_IFIGL_MULTIPLEREFDOC-CREATIONDATE table field - Journal Entry Creation Date
▼
Description: Journal Entry Creation Date Field Name: CREATIONDATE Data Element: FIS_CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_IFIGL_MULTIPLEREFDOC table
|
FCLM_S_ACCOUNT_STAGING_CDS-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_S_ACCOUNT_STAGING_CDS table
|
FCO_COST_CC_GROUP_AND_HIER-CREATIONDATE table field - Creation date
▼
Description: Creation date Field Name: CREATIONDATE Data Element: CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_COST_CC_GROUP_AND_HIER table
|
FINS_CFIN_S_AV_PO_EX_ACCAS-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_ACCAS table
|
FJEPS_GOODSMOV_HEADER_DATA-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FJEPS_GOODSMOV_HEADER_DATA table
|
ISCADISPUTEDDOCUMENTTP3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTEDDOCUMENTTP3_DR table
|
ISCENTRALPURCHASEORDERTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASEORDERTP_D table
|
ISCNDNCONTRCLMREQITEMTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQITEMTP_DR table
|
ISCNDNCONTRCLMREQITMPARTTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQITMPARTTP table
|
ISCNDNCONTRCLMREQPARTTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQPARTTP_DR table
|
ISCONFIGNCHARCGROUPALLOCTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONFIGNCHARCGROUPALLOCTP table
|
ISCOSTCENTERACTIVITYTYPETP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTCENTERACTIVITYTYPETP table
|
ISGLACCOUNTINCOCDWITHDRAFT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOCDWITHDRAFT table
|
ISINSPPLANDPNDANTCHARCTP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANDPNDANTCHARCTP_D table
|
ISINSPPLANMATERIALASSGMTTP-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANMATERIALASSGMTTP table
|
ISMFGGOODSMOVEMENTEXCPTNTP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP table
|
ISMFGQUALIFNCERTCATEGORYTP-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTCATEGORYTP table
|
ISMFGQUALIFNCERTIFICATETP2-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTIFICATETP2 table
|
ISMFGQUALIFNWRKCTRASSGMTTP-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNWRKCTRASSGMTTP table
|
ISMPPURCHASINGSOURCEITEMWD-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMPPURCHASINGSOURCEITEMWD table
|
ISPREPAYMENTAGREEMENTTP_DR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPREPAYMENTAGREEMENTTP_DR table
|
ISPRODALLOCATIONOBJECTTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCATIONOBJECTTP_D table
|
ISPRODALLOCATIONSEQUENCETP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCATIONSEQUENCETP table
|
ISPRODUCTSTORAGELOCATIONWD-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTSTORAGELOCATIONWD table
|
ISPURCHASEREQUISITION_WD_D-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITION_WD_D table
|
ISPURCTRPARTNERSWITHDRAFT1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT1 table
|
ISPURCTRPARTNERSWITHDRAFT2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT2 table
|
ISPURCTRPARTNERWITHDRAFT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERWITHDRAFT_D table
|
ISPURGINFORECORDWWITHDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGINFORECORDWWITHDRAFT table
|
ISPURGQUOTAARRGMTWITHDRAFT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGQUOTAARRGMTWITHDRAFT table
|
ISPURREQNITMSOPENFORCONFTP-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNITMSOPENFORCONFTP table
|
ISPURREQNITMSOPENFORCONF_D-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNITMSOPENFORCONF_D table
|
ISQLTYFIRSTARTICLEINSPTP_D-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQLTYFIRSTARTICLEINSPTP_D table
|
ISQUALITYINPROCUREMENTTP_D-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP_D table
|
ISREQUESTFORQUOTATIONENHWD-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISREQUESTFORQUOTATIONENHWD table
|
ISRUNOVERHEADSTATISTICTP_D-CREATIONDATE table field - Date Overhead document was created
▼
Description: Date Overhead document was created Field Name: CREATIONDATE Data Element: FCO_OVHD_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNOVERHEADSTATISTICTP_D table
|
ISSCHEDULEAGMTWITHDRAFT1_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDULEAGMTWITHDRAFT1_D table
|
ISSLSPRCGCONDITIONRECORDTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP table
|
MMBSI_SRM_CONTRT_PARAM_STU-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMBSI_SRM_CONTRT_PARAM_STU table
|
MMPUR_PPR_S_RFQ_DRAFTS_HDR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PPR_S_RFQ_DRAFTS_HDR table
|
MMPUR_SSP_RETDL_ODATA_ITEM-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SSP_RETDL_ODATA_ITEM table
|
TDS_MMIM_GMVT_FDP_IND_ITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_MMIM_GMVT_FDP_IND_ITEM table
|
TSPURCHASEREQNACCTASSGMT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT_D table
|
WRF_POHF_DATA_AC_POSIG_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSIG_STY table
|
WRF_PPW_PPDFIELDCATART_STY-CREATIONDATE table field - Date of Hierarchy Determination
▼
Description: Date of Hierarchy Determination Field Name: CREATIONDATE Data Element: WRF_PPW_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PPW_PPDFIELDCATART_STY table
|
/ISDFPS/FOLLOW_OUTTAB_ORDER-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/FOLLOW_OUTTAB_ORDER table
|
/MERP/MM_PO_ITEM_ENTITY_STR-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/MM_PO_ITEM_ENTITY_STR table
|
/SAPAPO/REMARK_SPP_NOTE_ALV-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: /SCMB/CREDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPAPO/REMARK_SPP_NOTE_ALV table
|
AHANDLINGUNITHEADERDELIVERY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AHANDLINGUNITHEADERDELIVERY table
|
BILLINGDOCUMENTHDR_S_GLO_CH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BILLINGDOCUMENTHDR_S_GLO_CH table
|
BUS1006_S_SEPA_MANDATE_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS1006_S_SEPA_MANDATE_DATA table
|
CMD_PRD_S_UNIFIED_PROD_DATA-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMD_PRD_S_UNIFIED_PROD_DATA table
|
E101IBUS1006_SEPA_MANDATE_X-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E101IBUS1006_SEPA_MANDATE_X table
|
E102US_EI_SEPA_MANDATE_DATA-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E102US_EI_SEPA_MANDATE_DATA table
|
FINS_CFIN_S_AV_CI_EX_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_HEADER table
|
FINS_CFIN_S_AV_PO_EX_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_HEADER table
|
FINS_CFIN_S_AV_SI_EX_HEADER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_HEADER table
|
FINS_CFIN_S_AV_SO_EX_HEADER-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_HEADER table
|
FINS_CFIN_S_AV_SO_EX_ITEM_K-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_ITEM_K table
|
FJEPS_GOODS_MOVEMENT_HEADER-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FJEPS_GOODS_MOVEMENT_HEADER table
|
FKKBIX_UNIT_PUBLIC_DATA_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKBIX_UNIT_PUBLIC_DATA_GFN table
|
FKKINV_UNIT_PUBLIC_DATA_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_PUBLIC_DATA_GFN table
|
FKKINV_UNIT_PUBLIC_DATA_GFN-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FKKINV_UNIT_PUBLIC_DATA_GFN table
|
FSL_STR_DYN_PPO_UPGRADE_SEL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSL_STR_DYN_PPO_UPGRADE_SEL table
|
ISBUSPARTRELATIONSHIPTP_2_D-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSPARTRELATIONSHIPTP_2_D table
|
ISCASECURITYDEPOSITMGMTTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCASECURITYDEPOSITMGMTTP_D table
|
ISCASECURITYDEPOSITREQDOCTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCASECURITYDEPOSITREQDOCTP table
|
ISCENTRALPURCHASECONTRACTTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASECONTRACTTP table
|
ISCENTRALPURCHASEORDERTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASEORDERTP_DR table
|
ISCNSLDTNJRNLENTRYITEMTP1_D-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNSLDTNJRNLENTRYITEMTP1_D table
|
ISFUNDSMGMTFUNCTIONALAREATP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSMGMTFUNCTIONALAREATP table
|
ISGLACCOUNTINCOAWITHDRAFT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOAWITHDRAFT_D table
|
ISGLACCTINCHTACCTSWITHDRAFT-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCHTACCTSWITHDRAFT table
|
ISGLACCTINCOCODEWITHDRAFT_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCOCODEWITHDRAFT_D table
|
ISINSPECTIONMETHODVERSIONTP-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONMETHODVERSIONTP table
|
ISINSPECTIONRESULTVALUETP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTVALUETP_D table
|
ISINSPPLANDPNDANTCHARCTP_DR-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANDPNDANTCHARCTP_DR table
|
ISINSPSUBSETRESULTVALUETP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSUBSETRESULTVALUETP_D table
|
ISPRODALLOCATIONOBJECTTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCATIONOBJECTTP_DR table
|
ISPUBLICSECTORBRFMESSAGETP2-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2 table
|
ISPURCHASEREQUISITION_WD_DR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITION_WD_DR table
|
ISPURCTRPARTNERSWITHDRAFT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT_D table
|
ISPURREQNACCTASSGMTWRKITMTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP table
|
ISPURREQNHDRITMACASWRKITMTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP table
|
ISPURREQNITMSOPENFORCONF_DR-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNITMSOPENFORCONF_DR table
|
ISQLTYFIRSTARTICLEINSPTP_DR-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQLTYFIRSTARTICLEINSPTP_DR table
|
ISQUALITYINPROCUREMENTTP_DR-CREATIONDATE table field - Create Date of Q-Info Record
▼
Description: Create Date of Q-Info Record Field Name: CREATIONDATE Data Element: QINFERSTDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QFREIDAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP_DR table
|
ISRUNOVERHEADSTATISTICTP_DR-CREATIONDATE table field - Date Overhead document was created
▼
Description: Date Overhead document was created Field Name: CREATIONDATE Data Element: FCO_OVHD_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNOVERHEADSTATISTICTP_DR table
|
ISRUNSETTLMTACTLSTATISTICTP-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLMTACTLSTATISTICTP table
|
ISSCHEDGAGRMTHDRWITHDRAFT_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTHDRWITHDRAFT_D table
|
ISSLSPRCGCONDITIONRECORDTP3-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP3 table
|
ISSLSPRCGCONDITIONRECORDTP4-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP4 table
|
LTR2_ODATA_CE_S_SUMMARY_DOC-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LTR2_ODATA_CE_S_SUMMARY_DOC table
|
LTR2_ODATA_CE_S_TRANSFERRUN-CREATIONDATE table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CREATIONDATE Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LTR2_ODATA_CE_S_TRANSFERRUN table
|
MMPUR_PO_ITEM_RESTORE_STATE-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_ITEM_RESTORE_STATE table
|
MMPUR_S_CCTR_API_HDR_MODIFY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_HDR_MODIFY table
|
MMPUR_S_CCTR_SEARCH_FILTERS-CREATIONDATE table field - Date
▼
Description: Date Field Name: CREATIONDATE Data Element: DATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_SEARCH_FILTERS table
|
MMPUR_S_EXT_LCL_PO_ITEM_ACC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LCL_PO_ITEM_ACC table
|
MMPUR_S_FOD_CONTRACT_DETAIL-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_FOD_CONTRACT_DETAIL table
|
MMPUR_S_SSP_REQ_ITEM_CHANGE-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_REQ_ITEM_CHANGE table
|
NGCS_CORE_CLASS_CHARC_INTER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CORE_CLASS_CHARC_INTER table
|
SDSLSPRC_APPROVAL_REQUEST_S-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDSLSPRC_APPROVAL_REQUEST_S table
|
TSPURCHASEREQNACCTASSGMT_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNACCTASSGMT_DR table
|
WRF_POHF_DATA_AC_POSCHE_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSCHE_STY table
|
/MERP/PM_TECH_OBJ_ENTITY_STR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_TECH_OBJ_ENTITY_STR table
|
/SAPPO/BAPI_STR_ORDER_DETAIL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BAPI_STR_ORDER_DETAIL table
|
/SAPPO/STR_HEADER_W_MR_PRTCL-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_HEADER_W_MR_PRTCL table
|
/SAPPO/STR_ORDER_DETAIL_AUTH-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_ORDER_DETAIL_AUTH table
|
BUS_EI_COM_BUPA_SEPA_MANDATE-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_COM_BUPA_SEPA_MANDATE table
|
BUS_EI_COM_BUPA_SEPA_MANDATE-CREATIONDATE table field - R3A BP: Change Information for Relevant User Data Field
▼
Description: R3A BP: Change Information for Relevant User Data Field Field Name: CREATIONDATE Data Element: GB_BAPIUPD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_COM_BUPA_SEPA_MANDATE table
|
BUS_EI_COM_SEPA_MANDATE_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_COM_SEPA_MANDATE_DATA table
|
CRMS4S_CONDITION_RECD_VALDTY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_CONDITION_RECD_VALDTY table
|
CRMS4S_EQUI_IL_SEARCH_RESULT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUI_IL_SEARCH_RESULT table
|
CRMS4S_EQUI_IL_SIMPLE_SEARCH-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_EQUI_IL_SIMPLE_SEARCH table
|
FAC_S_GLACCTINCOCODELISTITEM-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_GLACCTINCOCODELISTITEM table
|
FCLM_BAM_S_BANKACCT_REVISION-CREATIONDATE table field - Bank Account Created On
▼
Description: Bank Account Created On Field Name: CREATIONDATE Data Element: FCLM_BAM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_BAM_S_BANKACCT_REVISION table
|
FCO_COST_SPLITTING_STRUCTURE-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCO_COST_SPLITTING_STRUCTURE table
|
FINS_CFIN_S_AV_CI_EX_SRC_AIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_SRC_AIF table
|
FINS_CFIN_S_AV_PO_EX_ACCAS_K-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_ACCAS_K table
|
FINS_CFIN_S_AV_PO_EX_SRC_AIF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_SRC_AIF table
|
FINS_CFIN_S_AV_SI_EX_SRC_AIF-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_SRC_AIF table
|
FINS_CFIN_S_AV_SO_EX_ITEM_DB-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_ITEM_DB table
|
FINS_CFIN_S_AV_SO_EX_SRC_AIF-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_SRC_AIF table
|
FSBP_MAP_GENERAL_DATA_BUT000-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSBP_MAP_GENERAL_DATA_BUT000 table
|
HCMFAB_S_TIMESHEET_TIMEENTRY-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CATS_ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HCMFAB_S_TIMESHEET_TIMEENTRY table
|
ISBUSPARTRELATIONSHIPTP_2_DR-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISBUSPARTRELATIONSHIPTP_2_DR table
|
ISCASECURITYDEPOSITMGMTTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCASECURITYDEPOSITMGMTTP_DR table
|
ISCENTRALSUPPLIERQUOTATIONTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALSUPPLIERQUOTATIONTP table
|
ISCNDNCONTRCLMREQITMPARTTP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQITMPARTTP_D table
|
ISCNSLDTNJRNLENTRYITEMTP1_DR-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNSLDTNJRNLENTRYITEMTP1_DR table
|
ISCONFIGNCHARCGROUPALLOCTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONFIGNCHARCGROUPALLOCTP_D table
|
ISCOSTCENTERACTIVITYTYPETP_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTCENTERACTIVITYTYPETP_D table
|
ISDEFECT_TP_Q_SEL_BY_ROOT_EL-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_Q_SEL_BY_ROOT_EL table
|
ISGLACCOUNTINCOCDWITHDRAFT_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCOUNTINCOCDWITHDRAFT_D table
|
ISINSPPLANMATERIALASSGMTTP_D-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANMATERIALASSGMTTP_D table
|
ISINSPSUBSETRESULTVALUETP_DR-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSUBSETRESULTVALUETP_DR table
|
ISMAINTWORKREQUESTOVERVIEWTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTWORKREQUESTOVERVIEWTP table
|
ISMFGGOODSMOVEMENTEXCPTNTP_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_D table
|
ISMFGQUALIFNCERTCATEGORYTP_D-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTCATEGORYTP_D table
|
ISMFGQUALIFNCERTIFICATETP2_D-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTIFICATETP2_D table
|
ISMFGQUALIFNMATERIALASSGMTTP-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNMATERIALASSGMTTP table
|
ISMFGQUALIFNWRKCTRASSGMTTP_D-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNWRKCTRASSGMTTP_D table
|
ISMPPURCHASINGSOURCEITEMWD_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMPPURCHASINGSOURCEITEMWD_D table
|
ISPRODALLOCATIONSEQUENCETP_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCATIONSEQUENCETP_D table
|
ISPRODUCTSTORAGELOCATIONWD_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTSTORAGELOCATIONWD_D table
|
ISPURCTRPARTNERSWITHDRAFT1_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT1_D table
|
ISPURCTRPARTNERSWITHDRAFT2_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT2_D table
|
ISPURCTRPARTNERSWITHDRAFT3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT3_D table
|
ISPURCTRPARTNERSWITHDRAFT_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCTRPARTNERSWITHDRAFT_DR table
|
ISPURGINFORECORDWWITHDRAFT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGINFORECORDWWITHDRAFT_D table
|
ISPURGQUOTAARRGMTWITHDRAFT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGQUOTAARRGMTWITHDRAFT_D table
|
ISPURORDACCRSACCRSUBOBJECTTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDACCRSACCRSUBOBJECTTP table
|
ISPURREQNACCTASSGMTWRKITMTP1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP1 table
|
ISPURREQNACCTASSGMTWRKITMTP2-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP2 table
|
ISPURREQNHDRITMACASWRKITMTP1-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP1 table
|
ISPURREQNITMSOPENFORCONFTP_D-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNITMSOPENFORCONFTP_D table
|
ISREQUESTFORQUOTATIONENHWD_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISREQUESTFORQUOTATIONENHWD_D table
|
ISSCHEDGAGRMTHDRWITHDRAFT_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSCHEDGAGRMTHDRWITHDRAFT_DR table
|
ISSLSPRCGCONDITIONRECORDTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP_D table
|
ISSUPLREVALUSRDFNDCRITERIATP-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: MMPUR_ANA_CREATEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_CREATEDON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIATP table
|
ISSUPPLIERQUOTATIONCOMPARETP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERQUOTATIONCOMPARETP table
|
MMPUR_PREQUISITION_ACCTASGMT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PREQUISITION_ACCTASGMT table
|
MMPUR_SSP_RETDL_ODATA_HEADER-CREATIONDATE table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: CREATIONDATE Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SSP_RETDL_ODATA_HEADER table
|
MMPUR_S_CCTR_API_MODIFY_DATA-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_API_MODIFY_DATA table
|
MMPUR_S_CNTRLPURCONTR_HEADER-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CNTRLPURCONTR_HEADER table
|
MMPUR_S_PURCHASE_REQUISITION-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASE_REQUISITION table
|
MPES_CIMA_PLR_QUICKVIEW_INFO-CREATIONDATE table field - Valid-From Date
▼
Description: Valid-From Date Field Name: CREATIONDATE Data Element: DATUV Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_PLR_QUICKVIEW_INFO table
|
MPES_CIMA_PRO_QUICKVIEW_INFO-CREATIONDATE table field - Order Creation Date
▼
Description: Order Creation Date Field Name: CREATIONDATE Data Element: ORDERCREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_PRO_QUICKVIEW_INFO table
|
MPES_CIMA_PUO_QUICKVIEW_INFO-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_PUO_QUICKVIEW_INFO table
|
SDSLSPRC_APPROVAL_REQ_ITEM_S-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDSLSPRC_APPROVAL_REQ_ITEM_S table
|
WRF_POHF_DATA_AC_POSCHEG_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSCHEG_STY table
|
WRF_POHF_GRIDROW_AC_POSI_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_AC_POSI_STY table
|
WRF_POHF_GRIDROW_POSCHEG_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_POSCHEG_STY table
|
WRF_PPW_PPDPACHANGE_DATA_STY-CREATIONDATE table field - Date of Hierarchy Determination
▼
Description: Date of Hierarchy Determination Field Name: CREATIONDATE Data Element: WRF_PPW_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PPW_PPDPACHANGE_DATA_STY table
|
/SAPPO/BADI_STR_ORDER_DATA_IN-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BADI_STR_ORDER_DATA_IN table
|
/SAPPO/STR_ORDER_DETAIL_DIA_A-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_ORDER_DETAIL_DIA_A table
|
API_PAYMENTADVICE_DEEP_ENTITY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP API_PAYMENTADVICE_DEEP_ENTITY table
|
BUS_EI_COM_SEPA_MANDATE_DATAX-CREATIONDATE table field - R3A BP: Change Information for Relevant User Data Field
▼
Description: R3A BP: Change Information for Relevant User Data Field Field Name: CREATIONDATE Data Element: GB_BAPIUPD Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BUS_EI_COM_SEPA_MANDATE_DATAX table
|
EWASSUBCONTR_PO_DATA_POSITION-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASSUBCONTR_PO_DATA_POSITION table
|
FAC_S_CHARTOFACCOUNTSLISTITEM-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_CHARTOFACCOUNTSLISTITEM table
|
FAC_S_IGLACCOUNTINCOAWITHDRAF-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_IGLACCOUNTINCOAWITHDRAF table
|
FAC_S_IGLACCOUNTINCOAWITHDR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_IGLACCOUNTINCOAWITHDR_D table
|
FAC_S_IGLACCOUNTINCOCDWITHDRA-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_IGLACCOUNTINCOCDWITHDRA table
|
FAC_S_IGLACCOUNTINCOCDWITHD_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_IGLACCOUNTINCOCDWITHD_D table
|
FINS_CFIN_S_AV_CI_EX_HEADER_K-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_HEADER_K table
|
FINS_CFIN_S_AV_PO_EX_ACCAS_DB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_ACCAS_DB table
|
FINS_CFIN_S_AV_PO_EX_HEADER_K-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_HEADER_K table
|
FINS_CFIN_S_AV_SI_EX_HEADER_K-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_HEADER_K table
|
FINS_CFIN_S_AV_SO_EX_HEADER_K-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_HEADER_K table
|
ISCASECURITYDEPOSITREQDOCTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCASECURITYDEPOSITREQDOCTP_D table
|
ISCENTRALPURCHASECONTRACTTP_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASECONTRACTTP_D table
|
ISCNDNCONTRCLMREQITMPARTTP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMREQITMPARTTP_DR table
|
ISCNDNCONTRCLMVALDTNITMPARTTP-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMVALDTNITMPARTTP table
|
ISCNTRLPURCONTRVERSIONHISTORY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRVERSIONHISTORY table
|
ISCONFIGNCHARCGROUPALLOCTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCONFIGNCHARCGROUPALLOCTP_DR table
|
ISCOSTCENTERACTIVITYTYPETP_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: FIS_CC_ERFDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCOSTCENTERACTIVITYTYPETP_DR table
|
ISFUNDSMGMTFUNCTIONALAREATP_D-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSMGMTFUNCTIONALAREATP_D table
|
ISGLACCTINCHTACCTSWITHDRAFT_D-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISGLACCTINCHTACCTSWITHDRAFT_D table
|
ISINSPECTIONMETHODVERSIONTP_D-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONMETHODVERSIONTP_D table
|
ISINSPPLANMATERIALASSGMTTP_DR-CREATIONDATE table field - Date Record Created On
▼
Description: Date Record Created On Field Name: CREATIONDATE Data Element: ANDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANMATERIALASSGMTTP_DR table
|
ISMFGGOODSMOVEMENTEXCPTNTP_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGGOODSMOVEMENTEXCPTNTP_DR table
|
ISMFGQUALIFNCERTMATLASSGMTTP2-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTMATLASSGMTTP2 table
|
ISMPPURCHASINGSOURCEITEMWD_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMPPURCHASINGSOURCEITEMWD_DR table
|
ISPRODALLOCATIONSEQUENCETP_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PAL_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODALLOCATIONSEQUENCETP_DR table
|
ISPRODUCTSTORAGELOCATIONWD_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTSTORAGELOCATIONWD_DR table
|
ISPUBLICSECTORBRFMESSAGETP2_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_D table
|
ISPURGINFORECORDWWITHDRAFT_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURGINFORECORDWWITHDRAFT_DR table
|
ISPURREQNACCTASSGMTWRKITMTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP_D table
|
ISPURREQNHDRITMACASWRKITMTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP_D table
|
ISPURREQNITMSOPENFORCONFTP_DR-CREATIONDATE table field -
▼
Description: Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNITMSOPENFORCONFTP_DR table
|
ISREQUESTFORQUOTATIONENHWD_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISREQUESTFORQUOTATIONENHWD_DR table
|
ISRUNSETTLMTACTLSTATISTICTP_D-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLMTACTLSTATISTICTP_D table
|
ISSLSPRCGCONDITIONRECORDTP3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP3_D table
|
ISSLSPRCGCONDITIONRECORDTP4_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP4_D table
|
ISSLSPRCGCONDITIONRECORDTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP_DR table
|
ISSLSPRICINGCONDITIONRECORDTP-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRICINGCONDITIONRECORDTP table
|
ISVARIANTCONFIGURATIONSIMLNTP-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISVARIANTCONFIGURATIONSIMLNTP table
|
MMPUR_OUTLNE_MEOUTBAPIACCOUNT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLNE_MEOUTBAPIACCOUNT table
|
MMPUR_S_PROCMTHUB_SCHD_AGRMNT-CREATIONDATE table field - Last Changed On
▼
Description: Last Changed On Field Name: CREATIONDATE Data Element: AEDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PROCMTHUB_SCHD_AGRMNT table
|
MMPUR_S_PURCHASEORDER_HISTORY-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASEORDER_HISTORY table
|
MMPUR_S_PURCHASEORDER_HISTORY-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASEORDER_HISTORY table
|
MMPUR_S_PURCHASEORDER_HISTORY-CREATIONDATE table field - Requisition (request) date
▼
Description: Requisition (request) date Field Name: CREATIONDATE Data Element: BADAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASEORDER_HISTORY table
|
MPES_CIMA_NETW_QUICKVIEW_INFO-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: AUFERFDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_NETW_QUICKVIEW_INFO table
|
MPES_CIMA_PLR_ADDITIONAL_INFO-CREATIONDATE table field - Valid-From Date
▼
Description: Valid-From Date Field Name: CREATIONDATE Data Element: DATUV Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_PLR_ADDITIONAL_INFO table
|
TDS_MMIM_GMVT_TP_FDP_COL_ITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_MMIM_GMVT_TP_FDP_COL_ITEM table
|
TDS_MMIM_GMVT_TP_FDP_IND_ITEM-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_MMIM_GMVT_TP_FDP_IND_ITEM table
|
TDS_SD_SLS_FDP_SCHEDAGRMT_HDR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_SCHEDAGRMT_HDR table
|
TDS_SD_SLS_FDP_SCHEDAGRMT_ITM-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SD_SLS_FDP_SCHEDAGRMT_ITM table
|
WRF_POHF_GRIDROW_AC_POSIG_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_AC_POSIG_STY table
|
/SAPPO/BAPI_STR_ORDER_HDR_AUTH-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/BAPI_STR_ORDER_HDR_AUTH table
|
/SAPPO/STR_ORDER_DETAIL_DIALOG-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: /SAPPO/DTE_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPPO/STR_ORDER_DETAIL_DIALOG table
|
/SAPWF/ISQUALITYTASKTP______00-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/ISQUALITYTASKTP______00 table
|
BAPI_B1006_S_SEPA_MANDATE_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_B1006_S_SEPA_MANDATE_DATA table
|
BAPI_B1006_T_SEPA_MANDATE_DATA-CREATIONDATE table field - Date on which the object was created
▼
Description: Date on which the object was created Field Name: CREATIONDATE Data Element: BU_CRDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_B1006_T_SEPA_MANDATE_DATA table
|
CRMS4S_CONDITION_RECORD_ATTRIB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS4S_CONDITION_RECORD_ATTRIB table
|
FAC_S_PRFCTR_COMPANY_CHANGELOG-CREATIONDATE table field - Changed On
▼
Description: Changed On Field Name: CREATIONDATE Data Element: FCO_CC_CHANGEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FAC_S_PRFCTR_COMPANY_CHANGELOG table
|
FCLM_CP_S_ENTITY_PAYMENTDETAIL-CREATIONDATE table field - Date on Which Record Was Created
▼
Description: Date on Which Record Was Created Field Name: CREATIONDATE Data Element: HZDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_CP_S_ENTITY_PAYMENTDETAIL table
|
FCLM_S_ACCOUNT_STAGING_GL_ATTR-CREATIONDATE table field - Date on which the Record Was Created
▼
Description: Date on which the Record Was Created Field Name: CREATIONDATE Data Element: ERDAT_RF Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCLM_S_ACCOUNT_STAGING_GL_ATTR table
|
FINS_CFIN_S_AV_CI_EX_HEADER_DB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_CI_EX_HEADER_DB table
|
FINS_CFIN_S_AV_PO_EX_HEADER_DB-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_PO_EX_HEADER_DB table
|
FINS_CFIN_S_AV_SI_EX_HEADER_DB-CREATIONDATE table field - Day On Which Accounting Document Was Entered
▼
Description: Day On Which Accounting Document Was Entered Field Name: CREATIONDATE Data Element: CPUDT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SI_EX_HEADER_DB table
|
FINS_CFIN_S_AV_SO_EX_HEADER_DB-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_S_AV_SO_EX_HEADER_DB table
|
ISCADISPUTECASEFLLWUPPOSTI3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTECASEFLLWUPPOSTI3_DR table
|
ISCADISPUTECASEFLLWUPPOSTIN3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTECASEFLLWUPPOSTIN3_D table
|
ISCADISPUTECASEFLLWUPPOSTINGT3-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCADISPUTECASEFLLWUPPOSTINGT3 table
|
ISCASECURITYDEPOSITREQDOCTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCASECURITYDEPOSITREQDOCTP_DR table
|
ISCENTRALPURCHASECONTRACTTP_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASECONTRACTTP_DR table
|
ISCENTRALREQUESTFORQUOTATIONTP-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALREQUESTFORQUOTATIONTP table
|
ISCENTRALREQUESTFORQUOTATION_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALREQUESTFORQUOTATION_D table
|
ISCENTRALREQUESTFORQUOTATIO_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALREQUESTFORQUOTATIO_DR table
|
ISCENTRALSUPPLIERQUOTATIONTP_D-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALSUPPLIERQUOTATIONTP_D table
|
ISCENTRALSUPPLIERQUOTATIONT_DR-CREATIONDATE table field - Creation Date of Purchasing Document
▼
Description: Creation Date of Purchasing Document Field Name: CREATIONDATE Data Element: MMPUR_ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALSUPPLIERQUOTATIONT_DR table
|
ISCNDNCONTRCLMVALDTNITMPARTT_D-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMVALDTNITMPARTT_D table
|
ISCNDNCONTRCLMVALDTNITMPART_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: FIS_CPDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNDNCONTRCLMVALDTNITMPART_DR table
|
ISCNTRLPURCONTRVERSIONHISTOR_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRVERSIONHISTOR_D table
|
ISCNTRLPURCONTRVERSIONHISTO_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCONTRVERSIONHISTO_DR table
|
ISFNDSMGMTFUNCTIONALAREACORETP-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFNDSMGMTFUNCTIONALAREACORETP table
|
ISFNDSMGMTFUNCTIONALAREACORE_D-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFNDSMGMTFUNCTIONALAREACORE_D table
|
ISFNDSMGMTFUNCTIONALAREACOR_DR-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFNDSMGMTFUNCTIONALAREACOR_DR table
|
ISFUNDSMGMTFUNCTIONALAREATP_DR-CREATIONDATE table field - Functional Area Created on Date
▼
Description: Functional Area Created on Date Field Name: CREATIONDATE Data Element: FMIS_FAREA_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISFUNDSMGMTFUNCTIONALAREATP_DR table
|
ISINSPECTIONMETHODVERSIONTP_DR-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONMETHODVERSIONTP_DR table
|
ISMAINTWORKREQUESTOVERVIEWTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTWORKREQUESTOVERVIEWTP_D table
|
ISMAINTWORKREQUESTOVERVIEWT_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMAINTWORKREQUESTOVERVIEWT_DR table
|
ISMFGQUALIFNCERTCATEGORYDESCTP-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTCATEGORYDESCTP table
|
ISMFGQUALIFNCERTCATEGORYDESC_D-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTCATEGORYDESC_D table
|
ISMFGQUALIFNCERTMATLASSGMTT2_D-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTMATLASSGMTT2_D table
|
ISMFGQUALIFNCERTWRKCTRASSGM2_D-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTWRKCTRASSGM2_D table
|
ISMFGQUALIFNCERTWRKCTRASSGMTT2-CREATIONDATE table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CREATIONDATE Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNCERTWRKCTRASSGMTT2 table
|
ISMFGQUALIFNMATERIALASSGMTTP_D-CREATIONDATE table field - Start Date
▼
Description: Start Date Field Name: CREATIONDATE Data Element: BEGDATUM Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISMFGQUALIFNMATERIALASSGMTTP_D table
|
ISPRODUCTSTORAGELOCATIONWD1_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTSTORAGELOCATIONWD1_DR table
|
ISPRODUCTSTORAGELOCATIONWD2_DR-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: ERSDA Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPRODUCTSTORAGELOCATIONWD2_DR table
|
ISPUBLICSECTORBRFMESSAGETP2_DR-CREATIONDATE table field - Creation Date
▼
Description: Creation Date Field Name: CREATIONDATE Data Element: PS_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPUBLICSECTORBRFMESSAGETP2_DR table
|
ISPURORDACCRSACCRSUBOBJECTTP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDACCRSACCRSUBOBJECTTP_D table
|
ISPURORDACCRSACCRSUBOBJECTT_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURORDACCRSACCRSUBOBJECTT_DR table
|
ISPURREQNACCTASSGMTWRKITMT1_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMT1_DR table
|
ISPURREQNACCTASSGMTWRKITMT2_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMT2_DR table
|
ISPURREQNACCTASSGMTWRKITMTP1_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP1_D table
|
ISPURREQNACCTASSGMTWRKITMTP2_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP2_D table
|
ISPURREQNACCTASSGMTWRKITMTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNACCTASSGMTWRKITMTP_DR table
|
ISPURREQNHDRITMACASWRKITMT1_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT1_DR table
|
ISPURREQNHDRITMACASWRKITMT2_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT2_DR table
|
ISPURREQNHDRITMACASWRKITMT3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT3_DR table
|
ISPURREQNHDRITMACASWRKITMT4_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMT4_DR table
|
ISPURREQNHDRITMACASWRKITMTP1_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP1_D table
|
ISPURREQNHDRITMACASWRKITMTP2_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP2_D table
|
ISPURREQNHDRITMACASWRKITMTP3_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP3_D table
|
ISPURREQNHDRITMACASWRKITMTP4_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP4_D table
|
ISPURREQNHDRITMACASWRKITMTP_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURREQNHDRITMACASWRKITMTP_DR table
|
ISRUNSETTLMTACTLSTATISTICTP_DR-CREATIONDATE table field - Date Document was created
▼
Description: Date Document was created Field Name: CREATIONDATE Data Element: FCO_STLMT_RUN_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRUNSETTLMTACTLSTATISTICTP_DR table
|
ISSLSPRCGCONDITIONRECORDTP3_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP3_DR table
|
ISSLSPRCGCONDITIONRECORDTP4_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRCGCONDITIONRECORDTP4_DR table
|
ISSLSPRICINGCONDITIONRECORDT_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRICINGCONDITIONRECORDT_D table
|
ISSLSPRICINGCONDITIONRECORD_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSLSPRICINGCONDITIONRECORD_DR table
|
ISSUPLREVALUSRDFNDCRITERIATP_D-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: MMPUR_ANA_CREATEDON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: MMPUR_ANA_CREATEDON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPLREVALUSRDFNDCRITERIATP_D table
|
ISSUPPLIERQUOTATIONCOMPARETP_D-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERQUOTATIONCOMPARETP_D table
|
ISSUPPLIERQUOTATIONCOMPARET_DR-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSUPPLIERQUOTATIONCOMPARET_DR table
|
ISVARIANTCONFIGURATIONSIMLNT_D-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISVARIANTCONFIGURATIONSIMLNT_D table
|
ISVARIANTCONFIGURATIONSIMLN_DR-CREATIONDATE table field - Simulaiton: Created On
▼
Description: Simulaiton: Created On Field Name: CREATIONDATE Data Element: VCHCLF_SIM_CREATED_ON Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISVARIANTCONFIGURATIONSIMLN_DR table
|
MMPUR_PR_APRVL_CMPL_S_ACCLINES-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PR_APRVL_CMPL_S_ACCLINES table
|
MMPUR_S_PR_ACCTASSIGNMT_IMPORT-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ACCTASSIGNMT_IMPORT table
|
NGCS_CORE_CLASS_CHARACTERISTIC-CREATIONDATE table field - Date on which the record was created
▼
Description: Date on which the record was created Field Name: CREATIONDATE Data Element: ERDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NGCS_CORE_CLASS_CHARACTERISTIC table
|
SDAVC_TS_RESOURCE_DATA_UI_TREE-CREATIONDATE table field - Created On
▼
Description: Created On Field Name: CREATIONDATE Data Element: Data Type: STRG length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SDAVC_TS_RESOURCE_DATA_UI_TREE table
|
WRF_POHF_DATAEKPO_ALL_EKET_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATAEKPO_ALL_EKET_STY table
|
WRF_POHF_DATA_EKP_HASH_EKT_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_EKP_HASH_EKT_STY table
|
WRF_POHF_GRIDROW_AC_POSCHE_STY-CREATIONDATE table field - Purchasing Document Creation Date
▼
Description: Purchasing Document Creation Date Field Name: CREATIONDATE Data Element: ME_PDI_CREATIONDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_AC_POSCHE_STY table
|