Details |
IFILLPKTCMMDTY-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
IFILLPKTCMMDTY-COMMODITYORDERFILLPACKETUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYORDERFILLPACKETUUID Data Element: /BOBF/UUID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: SYSUUID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERFILLPACKETUUID
|
IFILLPKTCMMDTY-COMMODITYORDERREQUESTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYORDERREQUESTUUID Data Element: /BOBF/UUID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: SYSUUID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTUUID
|
IFILLPKTCMMDTY-CMMDTYORDERFILLPACKET table field - Commodity Derivative Order Fill Packet Sequence
▼
Description: Commodity Derivative Order Fill Packet Sequence Field Name: CMMDTYORDERFILLPACKET Data Element: CMMFDOF_FILLPACKETSEQUENCE Data Type: NUMC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYORDERFILLPACKET MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLPACKET
|
IFILLPKTCMMDTY-CMMDTYORDFILLPACKETTYPE table field - Commodity Derivative Fill Packet
▼
Description: Commodity Derivative Fill Packet Field Name: CMMDTYORDFILLPACKETTYPE Data Element: CMMFDOR_FILLPACKETTYPE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CMMFDOR_FILLPACKETTYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLPACKETTYPE
|
IFILLPKTCMMDTY-COMMODITYORDERFILLPACKETID table field - Commodity Derivative Order Fill Packet ID
▼
Description: Commodity Derivative Order Fill Packet ID Field Name: COMMODITYORDERFILLPACKETID Data Element: CMMFDOF_CMMDTYORDERFILLPKTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYORDERFILLPKTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERFILLPACKETID
|
IFILLPKTCMMDTY-CMMDTYFILLPACKETMSGORDID table field - Commodity Order Fill External Source Reference
▼
Description: Commodity Order Fill External Source Reference Field Name: CMMDTYFILLPACKETMSGORDID Data Element: CMMFDOF_CMMDTYORDFILLEXTORDREF Data Type: CHAR length (Dec): 60(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYORDFILLEXTORDREF MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYFILLPACKETMSGORDID
|
IFILLPKTCMMDTY-CMMDTYORDERFILLREQUESTTYPE table field - Commodity Derivative Fill Packet Type
▼
Description: Commodity Derivative Fill Packet Type Field Name: CMMDTYORDERFILLREQUESTTYPE Data Element: CMMFDOF_FILLTYPE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: CMMFDOF_FILLTYPE MemoryID: AppClass: SHLP: CMMFDOF_H_FILLTYPE SHLP Field: COMMODITYDERIVATIVEFILLTYPE ConvExit: See all SAP tables containing field CMMDTYORDERFILLREQUESTTYPE
|
IFILLPKTCMMDTY-CMMDTYORDFILLCOUNTERPARTYINFO table field - Commodity Derivative Counterparty Information
▼
Description: Commodity Derivative Counterparty Information Field Name: CMMDTYORDFILLCOUNTERPARTYINFO Data Element: CMMFDOR_COUNTERPARTYINFO Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOR_CMMDTYORDREQCNTRPARTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLCOUNTERPARTYINFO
|
IFILLPKTCMMDTY-CMMDTYORDREQFILLEDQTYINLOTS table field - Order Quantity In Lots
▼
Description: Order Quantity In Lots Field Name: CMMDTYORDREQFILLEDQTYINLOTS Data Element: CMMFDOF_CMMDTYFLPKTFLEDQTYLOTS Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYFLPKTFLEDQTYLOTS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQFILLEDQTYINLOTS
|
IFILLPKTCMMDTY-CMMDTYORDREQRMNGQTYINLOTS table field - Remaining Quantity In Lots
▼
Description: Remaining Quantity In Lots Field Name: CMMDTYORDREQRMNGQTYINLOTS Data Element: CMMFDOF_CMMDTYFLPKTRMGQTYLOTS Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYFLPKTRMGQTYLOTS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDREQRMNGQTYINLOTS
|
IFILLPKTCMMDTY-CMMDTYORDERFILLQUANTITYINLOTS table field - Order Quantity In Lots
▼
Description: Order Quantity In Lots Field Name: CMMDTYORDERFILLQUANTITYINLOTS Data Element: CMMFDOF_CMMDTYFLPKTFLEDQTYLOTS Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYFLPKTFLEDQTYLOTS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLQUANTITYINLOTS
|
IFILLPKTCMMDTY-CMMDTYORDFILLREJECTIONREASON table field - Fill Rejection Reason
▼
Description: Fill Rejection Reason Field Name: CMMDTYORDFILLREJECTIONREASON Data Element: CMMFDOF_FILLREJECTIONREASON Data Type: CHAR length (Dec): 255(0) Check table: Conversion Routine: Domain Name: CMMFDOF_FILLREJECTIONREASON MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLREJECTIONREASON
|
IFILLPKTCMMDTY-CMMDTYORDFILLMULTILEGTYPE table field - Multileg Type
▼
Description: Multileg Type Field Name: CMMDTYORDFILLMULTILEGTYPE Data Element: CMMFDOF_MULTILEGTYPE Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOF_MULTILEGTYPE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLMULTILEGTYPE
|
IFILLPKTCMMDTY-CMMDTYORDERFILLPACKETSTATUS table field - Commodity Order Fill Packet Status
▼
Description: Commodity Order Fill Packet Status Field Name: CMMDTYORDERFILLPACKETSTATUS Data Element: CMMFDOF_CMMDTYFLPKTSTATUS Data Type: NUMC length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOF_CMMDTYFLPKTSTATUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERFILLPACKETSTATUS
|
IFILLPKTCMMDTY-CMMDTYORDERISFILLWITHORDER table field - Commodity Derivative Fill Uploaded With Order
▼
Description: Commodity Derivative Fill Uploaded With Order Field Name: CMMDTYORDERISFILLWITHORDER Data Element: CMMFDOF_ISFILLWITHORDER Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CMMFDOF_ISFILLWITHORDER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERISFILLWITHORDER
|
IFILLPKTCMMDTY-CMMDTYORDFILLFIRSTDISTRDDTETME table field - Commodity Order Fill First Distribution Date Time
▼
Description: Commodity Order Fill First Distribution Date Time Field Name: CMMDTYORDFILLFIRSTDISTRDDTETME Data Element: CMMFDOF_FILLFIRSTDISTRDDTETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLFIRSTDISTRDDTETME
|
IFILLPKTCMMDTY-CMMDTYORDFILLLASTDISTRDDATETME table field - Commodity Order Fill Last Distribution Date Time
▼
Description: Commodity Order Fill Last Distribution Date Time Field Name: CMMDTYORDFILLLASTDISTRDDATETME Data Element: CMMFDOF_FILLLASTDISTRDDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDFILLLASTDISTRDDATETME
|
IFILLPKTCMMDTY-COMMODITYORDERREQUESTTRADER table field - Trader
▼
Description: Trader Field Name: COMMODITYORDERREQUESTTRADER Data Element: RDEALER Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: RDEALER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERREQUESTTRADER
|
IFILLPKTCMMDTY-COMMODITYORDERFILLDECIDEDBY table field - Decided By
▼
Description: Decided By Field Name: COMMODITYORDERFILLDECIDEDBY Data Element: CMMFDOF_DECIDEDBY Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERFILLDECIDEDBY
|
IFILLPKTCMMDTY-COMMODITYORDERFILLDECIDEDON table field - Decided On
▼
Description: Decided On Field Name: COMMODITYORDERFILLDECIDEDON Data Element: CMMFDOF_DECIDEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYORDERFILLDECIDEDON
|
IFILLPKTCMMDTY-COMMODITY table field - Commodity
▼
Description: Commodity Field Name: COMMODITY Data Element: TBA_STOEFFCHEN Data Type: CHAR length (Dec): 18(0) Check table: TBAC_PHYSCOMM Conversion Routine: Domain Name: TBA_STOEFFCHEN MemoryID: AppClass: SHLP: TBAH_STOEFFCHEN SHLP Field: COMMODITY ConvExit: See all SAP tables containing field COMMODITY
|
IFILLPKTCMMDTY-COMMODITYSUBACCOUNTUUID table field - UUID serving as key (parent key, root key)
▼
Description: UUID serving as key (parent key, root key) Field Name: COMMODITYSUBACCOUNTUUID Data Element: /BOBF/UUID Data Type: RAW length (Dec): 16(0) Check table: Conversion Routine: Domain Name: SYSUUID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYSUBACCOUNTUUID
|
IFILLPKTCMMDTY-DERIVATIVECONTRSPECIFICATION table field - Derivative Contract Specification (DCS)
▼
Description: Derivative Contract Specification (DCS) Field Name: DERIVATIVECONTRSPECIFICATION Data Element: CMMFSA_DERIVATIVECONTRACTSPEC Data Type: CHAR length (Dec): 20(0) Check table: TBAC_DCS Conversion Routine: Domain Name: TBA_DCSID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DERIVATIVECONTRSPECIFICATION
|
IFILLPKTCMMDTY-COMMODITYSUBACCOUNT table field - Commodity Subaccount ID
▼
Description: Commodity Subaccount ID Field Name: COMMODITYSUBACCOUNT Data Element: CMMFSA_SUBACCOUNTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFSA_SUBACCOUNTID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYSUBACCOUNT
|
IFILLPKTCMMDTY-COMMODITYSUBACCOUNTNAME table field - Commodity Subaccount Name
▼
Description: Commodity Subaccount Name Field Name: COMMODITYSUBACCOUNTNAME Data Element: CMMFSA_SUBACCOUNTNAME Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: CMMFSA_SUBACCOUNTNAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMMODITYSUBACCOUNTNAME
|
IFILLPKTCMMDTY-COMMODITYDERIVATIVEBROKER table field - Commodity Derivative Broker
▼
Description: Commodity Derivative Broker Field Name: COMMODITYDERIVATIVEBROKER Data Element: CMMFDOR_BROKER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYDERIVATIVEBROKER
|
IFILLPKTCMMDTY-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: CHAR length (Dec): 4(0) Check table: T001 Conversion Routine: Domain Name: BUKRS MemoryID: BUK AppClass: FB SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
|
IFILLPKTCMMDTY-PROFITCENTER table field - Profit Center
▼
Description: Profit Center Field Name: PROFITCENTER Data Element: PRCTR Data Type: CHAR length (Dec): 10(0) Check table: CEPC Conversion Routine: ALPHA Domain Name: PRCTR MemoryID: PRC AppClass: KE SHLP: PRCTR_EMPTY SHLP Field: PRCTR ConvExit: ALPHA See all SAP tables containing field PROFITCENTER
|
IFILLPKTCMMDTY-COMMODITYORDERREQUEST table field - Commodity Derivative Order Request ID
▼
Description: Commodity Derivative Order Request ID Field Name: COMMODITYORDERREQUEST Data Element: CMMFDOR_ORDERREQUESTID Data Type: NUMC length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: CMMFDOR_ORDERREQUESTID MemoryID: CMMORD AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field COMMODITYORDERREQUEST
|
IFILLPKTCMMDTY-CMMDTYORDERDATETIME table field - Timestamp of record creation
▼
Description: Timestamp of record creation Field Name: CMMDTYORDERDATETIME Data Element: CMMFDOR_CREATIONDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERDATETIME
|
IFILLPKTCMMDTY-CMMDTYORDERREQUESTTYPE table field - Commodity Derivative Order Request Type
▼
Description: Commodity Derivative Order Request Type Field Name: CMMDTYORDERREQUESTTYPE Data Element: CMMFDOR_ORDERTYPE Data Type: CHAR length (Dec): 4(0) Check table: CMMFDOR_C_ORDTYP Conversion Routine: Domain Name: CMMFDOR_ORDERTYPE MemoryID: CMMODY AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTTYPE
|
IFILLPKTCMMDTY-CMMDTYORDERREQUESTSOURCE table field - Commodity Derivative Order Request Source
▼
Description: Commodity Derivative Order Request Source Field Name: CMMDTYORDERREQUESTSOURCE Data Element: CMMFDOR_CMMDTYORDREQUESTSOURCE Data Type: NUMC length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOR_CMMDTYORDREQUESTSOURCE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTSOURCE
|
IFILLPKTCMMDTY-CMMDTYORDERREQUESTREASON table field - Commodity Derivative Order Request Reason
▼
Description: Commodity Derivative Order Request Reason Field Name: CMMDTYORDERREQUESTREASON Data Element: CMMFDOR_ORDERREQUESTRSN Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: CMMFDOR_ORDERREQUESTRSN MemoryID: CMMODR AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTREASON
|
IFILLPKTCMMDTY-CMMDTYORDERREQUESTQUANTITY table field - Commodity Derivative Order Request Quantity For Filling
▼
Description: Commodity Derivative Order Request Quantity For Filling Field Name: CMMDTYORDERREQUESTQUANTITY Data Element: CMMFDOR_CMMDTYORDREQUESTQTY Data Type: DEC length (Dec): 30(3) Check table: Conversion Routine: Domain Name: CMMFDOR_CMMDTYORDREQUESTQTY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTQUANTITY
|
IFILLPKTCMMDTY-CMMDTYORDERREQUESTQUANTITYUNIT table field - Derivative Contract Specification Unit of Measure
▼
Description: Derivative Contract Specification Unit of Measure Field Name: CMMDTYORDERREQUESTQUANTITYUNIT Data Element: CMMFDOR_ORDREQDCSUOM Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: CMMFDOR_ORDREQDCSUOM MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CMMDTYORDERREQUESTQUANTITYUNIT
|
IFILLPKTCMMDTY-CREATEDBYUSER table field - Created By User
▼
Description: Created By User Field Name: CREATEDBYUSER Data Element: CMMFDOF_CREATEDBY Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATEDBYUSER
|
IFILLPKTCMMDTY-CREATIONDATETIME table field - Timestamp of record creation
▼
Description: Timestamp of record creation Field Name: CREATIONDATETIME Data Element: CMMFDOF_CREATIONDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATETIME
|
IFILLPKTCMMDTY-LASTCHANGEDBYUSER table field - Last changed by user ID
▼
Description: Last changed by user ID Field Name: LASTCHANGEDBYUSER Data Element: CMMFDOF_LASTCHANGEDBYUSER Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: USNAM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDBYUSER
|
IFILLPKTCMMDTY-LASTCHANGEDATETIME table field - Timestamp of last change
▼
Description: Timestamp of last change Field Name: LASTCHANGEDATETIME Data Element: CMMFDOF_LASTCHANGEDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTCHANGEDATETIME
|