SAP LASTCHANGEDATETIME field - Change Time Stamp details in SAP


SAP LASTCHANGEDATETIME field summary

Object Name: LASTCHANGEDATETIME
Dictionary Type:
Description: Change Time Stamp


SAP field LASTCHANGEDATETIME is available in the following tables

Details
CLOGO-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CLOGO table

ILOGO-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILOGO table

IFVDRR-LASTCHANGEDATETIME table field - Time Changed

Description: Time Changed
Field Name: LASTCHANGEDATETIME
Data Element: VEC_TIMESTAMP_M
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFVDRR table

IPRSSP-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRSSP table

COMTEXT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COMTEXT table

CQTWFIN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CQTWFIN table

CSOWFIN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSOWFIN table

IADDRTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IADDRTP table

ICHMMAT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMMAT table

IOMTEXT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IOMTEXT table

APROCORD-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APROCORD table

CASSETTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CASSETTP table

CPOHDRTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPOHDRTP table

CPURREQN-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPURREQN table

IEHSCTRL-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSCTRL table

IFVRCUBE-LASTCHANGEDATETIME table field - Time Changed

Description: Time Changed
Field Name: LASTCHANGEDATETIME
Data Element: VEC_TIMESTAMP_M
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFVRCUBE table

IGRIRINF-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IGRIRINF table

IMFGBPTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGBPTP table

IPURREQN-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQN table

PMLRDPER-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMLRDPER table

PPIRHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPIRHIST table

APRODNORD-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APRODNORD table

CEMBCNTRY-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEMBCNTRY table

CEREVIEWQ-LASTCHANGEDATETIME table field - Created On

Description: Created On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CREATEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEREVIEWQ table

CPURORDTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPURORDTP table

ICAOPACTY-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICAOPACTY table

IEMBCNTRY-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEMBCNTRY table

IGRIRPRED-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IGRIRPRED table

IJITCHDTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCHDTP table

IJITODBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITODBSC table

IMAKEBTTP-LASTCHANGEDATETIME table field - Creation Date and Time

Description: Creation Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FARP_PRQ_CR_DATE
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAKEBTTP table

IPRTRDCLS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRTRDCLS table

IPURORDTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURORDTP table

PGRIRPRED-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRPRED table

PJITODBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PJITODBSC table

PMLBALBCF-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMLBALBCF table

PPIRHIST0-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPIRHIST0 table

PSDSLSQPD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSDSLSQPD table

PWPIRHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PWPIRHIST table

APURREQITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APURREQITM table

CABAPCSSTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CABAPCSSTP table

CEMBOAWITP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEMBOAWITP table

CEPREVIEWQ-LASTCHANGEDATETIME table field - Created On

Description: Created On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CREATEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEPREVIEWQ table

CGLACOCDLI-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CGLACOCDLI table

CGLCOALIST-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CGLCOALIST table

CPLNSCPHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPLNSCPHDR table

CREDITMEMO-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CREDITMEMO table

CSDSLSPLAN-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSDSLSPLAN table

CSHPDWKLST-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSHPDWKLST table

CSISPLNSVH-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSISPLNSVH table

ICSTRTHWTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRTHWTP table

ICSTRTSWTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRTSWTP table

IEMBOAWITP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEMBOAWITP table

IFIACOCDLI-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIACOCDLI table

IMFGBPWCTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGBPWCTP table

IMLBALANCE-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMLBALANCE table

IMLCUBELIT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMLCUBELIT table

IPLNSCPHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPLNSCPHDR table

IPRODUCTWD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRODUCTWD table

PEWMWTITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PEWMWTITEM table

PMLCUBEBAL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMLCUBEBAL table

PMLCUBELIT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMLCUBELIT table

PPLNSCPHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPLNSCPHDR table

PSCHOPERLC-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 17(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSCHOPERLC table

PSDSLSQPTD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSDSLSQPTD table

SEPM_ISOIC-LASTCHANGEDATETIME table field - EPM: Changed At

Description: EPM: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: SNWD_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SEPM_ISOIC table

SEPM_PSOIC-LASTCHANGEDATETIME table field - EPM: Changed At

Description: EPM: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: SNWD_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SEPM_PSOIC table

CCNTXISTSLG-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTXISTSLG table

CENGPROJECT-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENGPROJECT table

CJITPGDEFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITPGDEFTP table

CJRNLENICOR-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJRNLENICOR table

CMFGAHTASTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMFGAHTASTP table

CMLLINEITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMLLINEITEM table

CMMQTNENHWD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMQTNENHWD table

CMNGCCTLGTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMNGCCTLGTP table

CMRWFDETAIL-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMRWFDETAIL table

CPOMAINTHDR-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPOMAINTHDR table

CPOMAINTITM-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPOMAINTITM table

CRSHREQDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRSHREQDATA table

CSCCHKDGRTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_DOC_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSCCHKDGRTP table

CSPLREVLRSP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSPLREVLRSP table

CSUBSTRATTP-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSUBSTRATTP table

CSUBSTRATVH-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSUBSTRATVH table

IACELINEITM-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IACELINEITM table

IARPOSTRLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IARPOSTRLTP table

ICSTRTHDBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRTHDBSC table

ICSTRTHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRTHDRTP table

ICSTRTSWBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRTSWBSC table

IEHSRSKROOT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRSKROOT table

IEWMODOITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMODOITEM table

IFIGLACCHER-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLACCHER table

IJITCTRLCYC-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PK_LASTCHANGE_DATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCTRLCYC table

IMFGAHTASTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGAHTASTP table

IMLBASICBLA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMLBASICBLA table

IMLCURTPLIT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMLCURTPLIT table

IMMQTNENHWD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMQTNENHWD table

IMPERSNCODE-LASTCHANGEDATETIME table field - System Date on Which Data Record Was Changed

Description: System Date on Which Data Record Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: QDATUMAEND
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPERSNCODE table

IMPITEMLIST-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPITEMLIST table

IMPSALESODR-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPSALESODR table

IPURREQNHDR-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNHDR table

ISIENHANCED-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISIENHANCED table

ISQENHANCED-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISQENHANCED table

ISUBSTRATVH-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUBSTRATVH table

IWCCAPBYAOR-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWCCAPBYAOR table

IWCCAPOVWTP-LASTCHANGEDATETIME table field - Packed field

Description: Packed field
Field Name: LASTCHANGEDATETIME
Data Element: DEC15
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWCCAPOVWTP table

PACELINEITM-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PACELINEITM table

PFQMFLOWCSH-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFQMFLOWCSH table

PPOITEMPAI4-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOITEMPAI4 table

PPOITEMPAI6-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOITEMPAI6 table

PSCHEDOPERS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSCHEDOPERS table

APURCONTRACT-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APURCONTRACT table

CABOPSEGMENT-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CABOPSEGMENT table

CCNTRLPCONTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTRLPCONTP table

CCOSTELEMENT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCOSTELEMENT table

CCSTRTHWDRFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCSTRTHWDRFT table

CCSTRTSWDRFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCSTRTSWDRFT table

CEWMLDLISTHU-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEWMLDLISTHU table

CGRIRHISTCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CGRIRHISTCHG table

CIRMNGALLTXT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CIRMNGALLTXT table

CIRMNGSOSOVW-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CIRMNGSOSOVW table

CMPEMFGARCTP-LASTCHANGEDATETIME table field - Date of Last Change

Description: Date of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_DATE
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMPEMFGARCTP table

CPAOBJPLNGWD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPAOBJPLNGWD table

CPAYFRGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPAYFRGENATT table

CPMNOTIFHEAD-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPMNOTIFHEAD table

CPPMDOCUMENT-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMDOCUMENT table

CQUOTWLF1852-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CQUOTWLF1852 table

CSEVCHGSCORE-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSEVCHGSCORE table

CSORDWLF1873-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSORDWLF1873 table

CTRSFRGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CTRSFRGENATT table

CWORKPACKAGE-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CWORKPACKAGE table

ICNTRLPCONTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTRLPCONTP table

ICRREFMFGBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFMFGBOM table

ICSCUSTHDIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSCUSTHDIRE table

ICSTRTHDRBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRTHDRBSC table

IEREVIEWCUBE-LASTCHANGEDATETIME table field - Created On

Description: Created On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CREATEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEREVIEWCUBE table

IEWMWHSETASK-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMWHSETASK table

IFIFINSTATEH-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIFINSTATEH table

IFIGLCOALIST-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLCOALIST table

IICSSUBCLAIM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IICSSUBCLAIM table

IJITCUSTDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCUSTDATA table

IJITCUSTOMER-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCUSTOMER table

IMAINTITEMTO-LASTCHANGEDATETIME table field - Time Stamp for BI Delta Extraction

Description: Time Stamp for BI Delta Extraction
Field Name: LASTCHANGEDATETIME
Data Element: TSTMP_BW_EXT
Data Type: DEC
length (Dec): 16(0)
Check table:
Conversion Routine:
Domain Name: RKE_TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTITEMTO table

IMPEMFGARCTP-LASTCHANGEDATETIME table field - Date of Last Change

Description: Date of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_DATE
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEMFGARCTP table

IMPSTRUCTURE-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPSTRUCTURE table

IPLNSCPHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPLNSCPHDRTP table

IPPMPROJTASK-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMPROJTASK table

ISEVADJSCORE-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISEVADJSCORE table

ISRVCENTRSHT-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MMPUR_SES_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRVCENTRSHT table

PCDOTETERMNO-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCDOTETERMNO table

PCMM_PSMPC01-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCMM_PSMPC01 table

PGRIRHISTCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTCHG table

PMAINTSEARCH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMAINTSEARCH table

PPIRHISTBYDT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPIRHISTBYDT table

PPOICHGSCORE-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOICHGSCORE table

PPOSEVCHGHIS-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOSEVCHGHIS table

PRSHSTAFFREQ-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PRSHSTAFFREQ table

PTRSFRGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PTRSFRGENATT table

P_COMPONENTS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP P_COMPONENTS table

ACSMATHIERDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSMATHIERDIR table

ASALESINQUIRY-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASALESINQUIRY table

ASUPLREVALRES-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASUPLREVALRES table

CCHGIMPCTROUT-LASTCHANGEDATETIME table field - Task List Version: Last Change Time Stamp

Description: Task List Version: Last Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PLNVERSN_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGIMPCTROUT table

CCHGRECREFPPO-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFPPO table

CCHGRECREFPPU-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFPPU table

CCHGRECREFPSV-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFPSV table

CCHGRECREFROU-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFROU table

CCSTRTHDRDRFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCSTRTHDRDRFT table

CFIFINSTMTKPI-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIFINSTMTKPI table

CMEMORECORDTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMEMORECORDTP table

CMFGWIVERSION-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMFGWIVERSION table

CMPECRPOPOVER-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMPECRPOPOVER table

CMPEMFGARCGTP-LASTCHANGEDATETIME table field - Date of Last Change

Description: Date of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_DATE
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMPEMFGARCGTP table

COPENSALESODR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COPENSALESODR table

CPCMM_PSMPC01-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCMM_PSMPC01 table

CPRODUCTOBJPG-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPRODUCTOBJPG table

CPUBSECFORMTP-LASTCHANGEDATETIME table field - Last Changed Timestamp

Description: Last Changed Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PS_LAST_CHANGED_DATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPUBSECFORMTP table

CPURREQNFLLWI-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPURREQNFLLWI table

CSPLEVLRSPEVL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSPLEVLRSPEVL table

IBOMDETAILSTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMDETAILSTP table

ICRREFEBOMBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFEBOMBSC table

ICRREFOSRTGTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFOSRTGTP table

ICSFCTARADIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSFCTARADIRE table

ICSFSITEMHDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSFSITEMHDIR table

ICSPROJECTHDE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSPROJECTHDE table

ICSTRANTYPDIE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSTRANTYPDIE table

IDIROBJCHGREC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDIROBJCHGREC table

IEPPLNVERCUBE-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEPPLNVERCUBE table

IEPREVIEWCUBE-LASTCHANGEDATETIME table field - Created On

Description: Created On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CREATEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEPREVIEWCUBE table

IFIACOSTELMNT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIACOSTELMNT table

IFIGLACCOUNTH-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLACCOUNTH table

IFUNCTLOCATTR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFUNCTLOCATTR table

IMEMORECORDTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMEMORECORDTP table

IMFGSTDTEXTTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGSTDTEXTTP table

IMFGSTDTXTCAT-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGSTDTXTCAT table

IMFGWIVERSION-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGWIVERSION table

IMNTORDTOCUBE-LASTCHANGEDATETIME table field - Changed On Timestamp with Date and Time

Description: Changed On Timestamp with Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: RSLASTCHANGEDAT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMNTORDTOCUBE table

IMPEMFGARCGTP-LASTCHANGEDATETIME table field - Date of Last Change

Description: Date of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_DATE
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEMFGARCGTP table

IPCMM_PSMPC01-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCMM_PSMPC01 table

IPURREQNHDRTF-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNHDRTF table

IPURREQNHDRWD-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNHDRWD table

NCHGRECREFPSV-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP NCHGRECREFPSV table

PCHGSCOREHIST-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCHGSCOREHIST table

PPIRDAILYHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPIRDAILYHIST table

ACSCUSTHIERDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSCUSTHIERDIR table

ACSPPRFTCTRDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSPPRFTCTRDIR table

ACSPROJECTHDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSPROJECTHDIR table

CABOPSEGMENTTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CABOPSEGMENTTP table

CCHGRECREFSROU-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFSROU table

CENGPROJPLNQRY-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENGPROJPLNQRY table

CENTPREPRJWPDA-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENTPREPRJWPDA table

CEPPLNVERQUERY-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEPPLNVERQUERY table

CFIGLLITMQ0001-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGLLITMQ0001 table

CFIGRIRPRIOCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRPRIOCHG table

CFIGRIRPROCSIT-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRPROCSIT table

CFIGRIRRPDTCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRRPDTCHG table

CFIGRIRRPUSCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRRPUSCHG table

CFIGRIRRTCSCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRRTCSCHG table

CFIGRIRSTATCHG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRSTATCHG table

CFRMTMPGGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFRMTMPGGENATT table

CJITCUSTHDRTP1-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITCUSTHDRTP1 table

CMDQPRODDETAIL-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMDQPRODDETAIL table

CMMSEVCRITERIA-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMSEVCRITERIA table

CMPEACTNSTTGTP-LASTCHANGEDATETIME table field - Reason Code Last Changed Timestamp

Description: Reason Code Last Changed Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_REASON_CODE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMPEACTNSTTGTP table

CMTORDACTCOSTQ-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMTORDACTCOSTQ table

CPPMCHCKLSTIOP-LASTCHANGEDATETIME table field - Date on which object was last changed

Description: Date on which object was last changed
Field Name: LASTCHANGEDATETIME
Data Element: CGPL_CHANGED_ON
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMCHCKLSTIOP table

CPRITEMDETAILS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPRITEMDETAILS table

CRSHMNTSCHDSIM-LASTCHANGEDATETIME table field - Schedule Changed On / At

Description: Schedule Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: RSH_EAM_MAINT_SCHED_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRSHMNTSCHDSIM table

CSCONTRWLF1851-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSCONTRWLF1851 table

CSRVCENTRSHTWD-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MMPUR_SES_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSRVCENTRSHTWD table

CSUPACTTASKMON-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSUPACTTASKMON table

CWORKPKGDETAIL-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CWORKPKGDETAIL table

ESH_L_RPR_PP_H-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: /PLMB/RCP_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_L_RPR_PP_H table

ESH_U_RPR_PP_H-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: /PLMB/RCP_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_U_RPR_PP_H table

IANALACCRPOSTG-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IANALACCRPOSTG table

IBUFLVLPRPSLZN-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBUFLVLPRPSLZN table

ICPWORKPACKAGE-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPWORKPACKAGE table

ICSGLACCTHDIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSGLACCTHDIRE table

ICSMATHIERDIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSMATHIERDIRE table

ICSPBUSAREADIE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSPBUSAREADIE table

ICSPRFTCTRHIDE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSPRFTCTRHIDE table

ICSSUPPLIERHDE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSSUPPLIERHDE table

IEPREVDATACUBE-LASTCHANGEDATETIME table field - Created On

Description: Created On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CREATEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEPREVDATACUBE table

IEQUIPMENTATTR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEQUIPMENTATTR table

IFIGRIRHISTORY-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGRIRHISTORY table

IFIGRIRMONITOR-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGRIRMONITOR table

IFIMGMTACCCUBE-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIMGMTACCCUBE table

IJITCUSTHDRTP1-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCUSTHDRTP1 table

IMAINTITEMDATA-LASTCHANGEDATETIME table field - Time Stamp for BI Delta Extraction

Description: Time Stamp for BI Delta Extraction
Field Name: LASTCHANGEDATETIME
Data Element: TSTMP_BW_EXT
Data Type: DEC
length (Dec): 16(0)
Check table:
Conversion Routine:
Domain Name: RKE_TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTITEMDATA table

IMAINTTASKLIST-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTTASKLIST table

IMFGBOFFTMPLTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGBOFFTMPLTP table

IMPEACTNSTTGTP-LASTCHANGEDATETIME table field - Reason Code Last Changed Timestamp

Description: Reason Code Last Changed Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_REASON_CODE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEACTNSTTGTP table

IMTORDACTCOSTC-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMTORDACTCOSTC table

INOTIFITEMDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INOTIFITEMDATA table

IPMORDOPERDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMORDOPERDATA table

IPPMPROJTASKTP-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMPROJTASKTP table

IPURREQNHEADER-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNHEADER table

ISRVCENTRSHTTP-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: MMPUR_SES_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRVCENTRSHTTP table

ITSKMAILTAPI01-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITSKMAILTAPI01 table

PANALACCRPOSTG-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PANALACCRPOSTG table

PCLSUBCLAIMANL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCLSUBCLAIMANL table

PFCSTDMNDIHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFCSTDMNDIHIST table

PFIGRIRHISTORY-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIGRIRHISTORY table

PFIGRIRPROCSIT-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIGRIRPROCSIT table

PFIRECNCLNSITN-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIRECNCLNSITN table

PFQMBALANCECSH-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFQMBALANCECSH table

PFRMTMPGGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFRMTMPGGENATT table

PMAINTTASKLIST-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMAINTTASKLIST table

PMNTHLYPIRHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMNTHLYPIRHIST table

PPAYFRMTGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPAYFRMTGENATT table

PPIRHISTBYDATE-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPIRHISTBYDATE table

PPOMAINTHDRALL-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOMAINTHDRALL table

PPOMAINTITMACT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOMAINTITMACT table

PQTYVARLSTUPDT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PQTYVARLSTUPDT table

PSDSPWITHDRAFT-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSDSPWITHDRAFT table

PSEVPCCRITERIA-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSEVPCCRITERIA table

PWPIRHISTBYDTE-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PWPIRHISTBYDTE table

ACSPCOSTCTRHDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSPCOSTCTRHDIR table

ACSPRFTCTRHIDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSPRFTCTRHIDIR table

ACSSUPPLIERHDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSSUPPLIERHDIR table

ASALESQUOTATION-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASALESQUOTATION table

CACTYBYSUPPLIER-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CACTYBYSUPPLIER table

CCHGRCDOBJPGDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRCDOBJPGDOC table

CCHGRCDOBJPGPLS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRCDOBJPGPLS table

CDEBITMRWLF1988-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CDEBITMRWLF1988 table

CEMBWIPICINFOTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEMBWIPICINFOTP table

CEMBWIPRTINFOTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEMBWIPRTINFOTP table

CFIGRIRPROCNOTE-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGRIRPROCNOTE table

CINTPROJFACTSHT-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CINTPROJFACTSHT table

CMMSEVCRITERIAC-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMSEVCRITERIAC table

CMPEMFGARCGCATP-LASTCHANGEDATETIME table field - System Date on Which Data Record Was Changed

Description: System Date on Which Data Record Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: QDATUMAEND
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMPEMFGARCGCATP table

COPENQUOTATIONS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COPENQUOTATIONS table

CPPMPROJCONTROL-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMPROJCONTROL table

CPSFORMBUNDLETP-LASTCHANGEDATETIME table field - Last Changed At

Description: Last Changed At
Field Name: LASTCHANGEDATETIME
Data Element: PS_AETSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPSFORMBUNDLETP table

CPURGCATBYSUPPL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPURGCATBYSUPPL table

CRSHMNTSCHDSMOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRSHMNTSCHDSMOP table

CRSHMNTSIMORDOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRSHMNTSIMORDOP table

CSCHEDGAGRMTHDR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSCHEDGAGRMTHDR table

EHFNDV_PMT_DESC-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_PMT_DESC table

IBUSINESSUSERTP-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBUSINESSUSERTP table

ICHGRECREFPSVTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHGRECREFPSVTP table

ICNTXIBINDGRECD-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXIBINDGRECD table

ICRREFROUTINGTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFROUTINGTP table

ICSBILLPTYHDIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSBILLPTYHDIRE table

ICSCOSTCTRHDIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSCOSTCTRHDIRE table

ICSPFCTARHIDIRE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSPFCTARHIDIRE table

ICSPPRFTCTRHIDE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSPPRFTCTRHIDE table

IEMBWICOMPINFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEMBWICOMPINFTP table

IEMBWIPICINFOTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEMBWIPICINFOTP table

IEMBWIPRTINFOTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEMBWIPRTINFOTP table

ILSTMIUISTHISTP-LASTCHANGEDATETIME table field - Status Management Changed At

Description: Status Management Changed At
Field Name: LASTCHANGEDATETIME
Data Element: LMD_SM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILSTMIUISTHISTP table

IMATERIALLEDGER-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMATERIALLEDGER table

IMEMOWITHFILTER-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMEMOWITHFILTER table

IMFGWIVERSIONTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGWIVERSIONTP table

IMMPOMESSAGESTS-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 31(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMPOMESSAGESTS table

IMPEMFGARCGCATP-LASTCHANGEDATETIME table field - System Date on Which Data Record Was Changed

Description: System Date on Which Data Record Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: QDATUMAEND
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEMFGARCGCATP table

IMTORDACTCOSTDC-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMTORDACTCOSTDC table

IPMTASKLISTDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMTASKLISTDATA table

IPPMMYCHKLSTITM-LASTCHANGEDATETIME table field - Date on which object was last changed

Description: Date on which object was last changed
Field Name: LASTCHANGEDATETIME
Data Element: CGPL_CHANGED_ON
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMMYCHKLSTITM table

IPRODBUFPRPSLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRODBUFPRPSLTP table

IPSFORMBUNDLETP-LASTCHANGEDATETIME table field - Last Changed At

Description: Last Changed At
Field Name: LASTCHANGEDATETIME
Data Element: PS_AETSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPSFORMBUNDLETP table

IPURREQHDRDETTP-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQHDRDETTP table

IPURREQNADVNCDH-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNADVNCDH table

IPURREQNLASTMOD-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNLASTMOD table

IRSHMNTSCHSIMOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRSHMNTSCHSIMOP table

IRSHMNTSHSMOPTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRSHMNTSHSMOPTP table

ISRVCENTRSHTITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRVCENTRSHTITM table

IWIPRRQHDITMDET-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWIPRRQHDITMDET table

NCHGRCDOBJPGMAT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP NCHGRCDOBJPGMAT table

PFIGRIRHISFCHNG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIGRIRHISFCHNG table

PFIGRIRHISLCHNG-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIGRIRHISLCHNG table

PMMREQORDOUTSTS-LASTCHANGEDATETIME table field - Last Change Date/Time

Description: Last Change Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: APOC_LCHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMMREQORDOUTSTS table

POUTFRMGENATT03-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP POUTFRMGENATT03 table

POUTFRMGENATT05-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP POUTFRMGENATT05 table

POUTFRMGENATT06-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP POUTFRMGENATT06 table

PPOMAINTITEMALL-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOMAINTITEMALL table

PPRCVARLASTUPDT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPRCVARLASTUPDT table

PRSHSTAFFREQDET-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PRSHSTAFFREQDET table

PTIMEVARLSTUPDT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PTIMEVARLSTUPDT table

P_VALIDBOMITEMS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP P_VALIDBOMITEMS table

CABOPSEGMENTVALH-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CABOPSEGMENTVALH table

CACTIESBYPURGCAT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CACTIESBYPURGCAT table

CCNBKRECNCLNITEM-LASTCHANGEDATETIME table field - Timestamp when Data of EPIC BRS was last Changed

Description: Timestamp when Data of EPIC BRS was last Changed
Field Name: LASTCHANGEDATETIME
Data Element: EPIC_BRS_CHANGED_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNBKRECNCLNITEM table

CCNBKRECNCLSTMNT-LASTCHANGEDATETIME table field - Timestamp when Data of EPIC BRS was last Changed

Description: Timestamp when Data of EPIC BRS was last Changed
Field Name: LASTCHANGEDATETIME
Data Element: EPIC_BRS_CHANGED_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNBKRECNCLSTMNT table

CCREDITMRWLF1989-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCREDITMRWLF1989 table

CCUSTOMERPROJECT-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCUSTOMERPROJECT table

CCUSTPROJDETAILS-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCUSTPROJDETAILS table

CCUSTRTNITMF1708-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCUSTRTNITMF1708 table

CEMBWICOMPINFOTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEMBWICOMPINFOTP table

CEMPLBUSINESSUSR-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEMPLBUSINESSUSR table

CMDQLTYPRODBDRES-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMDQLTYPRODBDRES table

CMDQLTYPRODSARES-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMDQLTYPRODSARES table

CMFGBOFFTEMPLATE-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMFGBOFFTEMPLATE table

CPPMENTPRJRANKTP-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMENTPRJRANKTP table

CPPMPROBRROLSTTP-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMPROBRROLSTTP table

CPRODRTGVERINBOX-LASTCHANGEDATETIME table field - Task List Version: Last Change Time Stamp

Description: Task List Version: Last Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PLNVERSN_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPRODRTGVERINBOX table

CRRBSLSPRDYNITEM-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRRBSLSPRDYNITEM table

CSRVCENTRSH000WD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSRVCENTRSH000WD table

CSRVCENTRSH001WD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSRVCENTRSH001WD table

CSUPEVALRESPONSE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSUPEVALRESPONSE table

CUSERSETTINGITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUSERSETTINGITEM table

FINS_GRIRPROCHIS-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FINS_GRIRPROCHIS table

IABOPSEGMENTVALH-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABOPSEGMENTVALH table

IABOPVARIANTVALH-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABOPVARIANTVALH table

IBOMCOMPWITHDATE-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMCOMPWITHDATE table

ICHGRECDREFBOMIB-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHGRECDREFBOMIB table

ICNBKRECNCLNITEM-LASTCHANGEDATETIME table field - Timestamp when Data of EPIC BRS was last Changed

Description: Timestamp when Data of EPIC BRS was last Changed
Field Name: LASTCHANGEDATETIME
Data Element: EPIC_BRS_CHANGED_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNBKRECNCLNITEM table

ICNBKRECNCLNSTMN-LASTCHANGEDATETIME table field - Timestamp when Data of EPIC BRS was last Changed

Description: Timestamp when Data of EPIC BRS was last Changed
Field Name: LASTCHANGEDATETIME
Data Element: EPIC_BRS_CHANGED_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNBKRECNCLNSTMN table

ICSPCOSTCTRHIDIE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSPCOSTCTRHIDIE table

ICUSTOMERPROJECT-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICUSTOMERPROJECT table

IDDSTKLVLPRPLBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDDSTKLVLPRPLBOM table

IDISPUTECASEPRTC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDISPUTECASEPRTC table

IENGPROJPLANCUBE-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENGPROJPLANCUBE table

IENGPROJWITHROLE-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENGPROJWITHROLE table

IGEVALMAILTAPI02-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IGEVALMAILTAPI02 table

ILOCANALYSISCUBE-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILOCANALYSISCUBE table

IMEMOMSTRDATASIG-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMEMOMSTRDATASIG table

IMFGBPCERTASGNTP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGBPCERTASGNTP table

IMFGSTANDARDTEXT-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGSTANDARDTEXT table

IPPMPROJELEMPROG-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMPROJELEMPROG table

IPRODBUFLVLPRPSL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRODBUFLVLPRPSL table

IPRODBUFPRPSLADJ-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRODBUFPRPSLADJ table

ISRVCENTRSH000TP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRVCENTRSH000TP table

ISRVCENTRSH001TP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRVCENTRSH001TP table

ISRVCENTRSHTACCT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRVCENTRSHTACCT table

IUSERSETTIN000WD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IUSERSETTIN000WD table

IWIPURREQNHDRDET-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWIPURREQNHDRDET table

PDYMNTHWKPIRHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PDYMNTHWKPIRHIST table

PFIGRIRHISTSCSSR-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIGRIRHISTSCSSR table

PFIGRIRSITNTRGGR-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIGRIRSITNTRGGR table

PFSITEMMAPHDRDEF-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFSITEMMAPHDRDEF table

PGRIRHISTNXTPRIO-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTNXTPRIO table

PGRIRHISTNXTREDT-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTNXTREDT table

PGRIRHISTNXTREPN-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTNXTREPN table

PGRIRHISTNXTRTCS-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTNXTRTCS table

PGRIRHISTNXTSTAT-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTNXTSTAT table

PGRIRHISTPRDCCSR-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTPRDCCSR table

PGRIRHISTPRIOCH2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTPRIOCH2 table

PGRIRHISTPRIOCH3-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTPRIOCH3 table

PGRIRHISTRPDTCH2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTRPDTCH2 table

PGRIRHISTRPDTCH3-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTRPDTCH3 table

PGRIRHISTRPUSCH2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTRPUSCH2 table

PGRIRHISTRPUSCH3-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTRPUSCH3 table

PGRIRHISTRTCSCH2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTRTCSCH2 table

PGRIRHISTRTCSCH3-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTRTCSCH3 table

PGRIRHISTSTATCH2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTSTATCH2 table

PGRIRHISTSTATCH3-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGRIRHISTSTATCH3 table

PMMREQORDOUTSTS1-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMMREQORDOUTSTS1 table

PMNTHLYHISTBYDTE-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMNTHLYHISTBYDTE table

PPOMAINTHDRDRAFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOMAINTHDRDRAFT table

PPOMAINTITMDRAFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPOMAINTITMDRAFT table

PQLTYNOTILSTUPDT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PQLTYNOTILSTUPDT table

PQLTYVARLASTUPDT-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PQLTYVARLASTUPDT table

PRRBSLSPRDYNITEM-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PRRBSLSPRDYNITEM table

PSLVDDSPSTSDURN2-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSLVDDSPSTSDURN2 table

PVCHSIMDRFTADMIN-LASTCHANGEDATETIME table field - Draft Last Changed On

Description: Draft Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: SDRAFT_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PVCHSIMDRFTADMIN table

V_PMMO_CNSMP_HST-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP V_PMMO_CNSMP_HST table

V_PMMO_GRPTF_HST-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP V_PMMO_GRPTF_HST table

V_PMMO_STOCK_HST-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP V_PMMO_STOCK_HST table

V_PMMO_TRNST_HST-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP V_PMMO_TRNST_HST table

EBAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBAN table

EBAV-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBAV table

EINA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EINA table

EKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EKKO table

EORD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EORD table

ISOR-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISOR table

KBLD-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP KBLD table

KBLK-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP KBLK table

RBKP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RBKP table

RKPF-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RKPF table

WRF1-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WRF1 table

CCCFI-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCCFI table

CHUMO-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CHUMO table

CKBLK-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CKBLK table

EBAN1-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBAN1 table

EBANU-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBANU table

EBANW-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBANW table

EINAU-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EINAU table

EORDU-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EORDU table

FEBAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FEBAN table

ICCFI-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCFI table

ICECA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICECA table

IKBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IKBOM table

ILISU-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISU table

IORGM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IORGM table

ISOTD-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: ATP_SOT_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISOTD table

IVCOD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IVCOD table

UEBAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP UEBAN table

UEORD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP UEORD table

VKBLK-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VKBLK table

VSTKO-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VSTKO table

VSTPO-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VSTPO table

ADDR_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ADDR_D table

CEWMWO-LASTCHANGEDATETIME table field - Time of Change

Description: Time of Change
Field Name: LASTCHANGEDATETIME
Data Element: /SCWM/DE_CHANGED_DT_NOCONV
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEWMWO table

CRPOVH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRPOVH table

IABAGT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABAGT table

IBATCH-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBATCH table

ICRACC-LASTCHANGEDATETIME table field - Date and Time of Changing Context

Description: Date and Time of Changing Context
Field Name: LASTCHANGEDATETIME
Data Element: /PLMB/AUTH_ACC_CHANGE_DATTI
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRACC table

IDGUOR-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDGUOR table

IINDVM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINDVM table

IMDSUB-LASTCHANGEDATETIME table field - Substitution Last Changed Date

Description: Substitution Last Changed Date
Field Name: LASTCHANGEDATETIME
Data Element: MD_SUBSTN_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDSUB table

IMFGBP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGBP table

IMMQTN-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMQTN table

IMMRFQ-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMRFQ table

IMPEOA-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOA table

IPCUSE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCUSE table

MCHN_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MCHN_D table

MCRBHD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MCRBHD table

MCRBKP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MCRBKP table

MPLA_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPLA_D table

PACTLG-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PACTLG table

PASQNC-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PASQNC table

PEWMWO-LASTCHANGEDATETIME table field - Time of Change

Description: Time of Change
Field Name: LASTCHANGEDATETIME
Data Element: /SCWM/DE_CHANGED_DT_NOCONV
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PEWMWO table

PMFGBP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMFGBP table

PSTX_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSTX_D table

ALLOTAG-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ALLOTAG table

ARFQHDR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ARFQHDR table

BDIEINA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP BDIEINA table

BDIEKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP BDIEKKO table

CAMOUNT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CAMOUNT table

CENGSNP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENGSNP table

CMNGINC-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMNGINC table

CORIDEX-LASTCHANGEDATETIME table field - Last Change Date/Time

Description: Last Change Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: APOC_LCHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CORIDEX table

CSOTDTP-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: ATP_SOT_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSOTDTP table

EAM_MJP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EAM_MJP table

FAAESMD-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAAESMD table

IABOPCS-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABOPCS table

ICCBAHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCBAHD table

ICCFAHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCFAHD table

ICCFITP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCFITP table

ICCSGHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCSGHD table

ICHMREV-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMREV table

ICHMSYN-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMSYN table

ICSHFLW-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSHFLW table

ICTRLCL-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICTRLCL table

IFMKBLD-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFMKBLD table

IINCDAM-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCDAM table

IINCEQU-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCEQU table

ILOCREV-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILOCREV table

IMPEOAN-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOAN table

IOVDCVC-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IOVDCVC table

IPACTLG-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPACTLG table

IPASQNC-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPASQNC table

IPCLOGO-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCLOGO table

IPCPHRS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRS table

IPCTASK-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCTASK table

IPOACSO-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPOACSO table

IPPMTPM-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMTPM table

IPRITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRITEM table

ISOTDTP-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: ATP_SOT_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISOTDTP table

ITRADOC-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITRADOC table

MITEM_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MITEM_D table

PACTLGD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PACTLGD table

PADBKFC-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PADBKFC table

PASQNCD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PASQNCD table

PPHRSAD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPHRSAD table

PPURCTR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPURCTR table

P_ITEMS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP P_ITEMS table

VEINAUA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VEINAUA table

VEINAUB-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VEINAUB table

ABOPCS_D-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABOPCS_D table

ALLOTAGT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ALLOTAGT table

APLNDORD-LASTCHANGEDATETIME table field - Last Change to Planned Order: Time Stamp

Description: Last Change to Planned Order: Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PSTMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APLNDORD table

APRODUCT-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APRODUCT table

APURGQTA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APURGQTA table

ASDBDREQ-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASDBDREQ table

CAPP_BOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CAPP_BOM table

CAPP_ITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CAPP_ITM table

CCMPTASK-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCMPTASK table

CCUSTRET-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCUSTRET table

CDGUORTP-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CDGUORTP table

COMTEXTT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COMTEXTT table

CPMRPSIM-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPMRPSIM table

CPRODUCT-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPRODUCT table

EBAN_MEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBAN_MEM table

EBAN_VSR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EBAN_VSR table

EKKODATA-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EKKODATA table

FBG_EKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FBG_EKKO table

IAGTROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IAGTROOT table

IALLWNCD-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLWNCD table

IASSETTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IASSETTP table

IBATCHTP-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBATCHTP table

IBATCHVH-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBATCHVH table

IBOOVDEF-LASTCHANGEDATETIME table field - Task List Version: Last Change Time Stamp

Description: Task List Version: Last Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PLNVERSN_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOOVDEF table

ICCFTTHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCFTTHD table

ICHMHING-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMHING table

ICHMROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMROOT table

ICMDTYCD-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMDTYCD table

IDGUORTP-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDGUORTP table

IECRATTR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IECRATTR table

IFMROPOS-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFMROPOS table

IGLACOCD-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IGLACOCD table

IINCINVP-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCINVP table

IINCPROP-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCPROP table

ILISUCUS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISUCUS table

ILISUSAP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISUSAP table

ILISUVAR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISUVAR table

ILMROUTE-LASTCHANGEDATETIME table field - Timestamp

Description: Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LMD_COM_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILMROUTE table

IMPESASA-LASTCHANGEDATETIME table field - UTC Time Stamp (YYYYMMDDhhmmss)

Description: UTC Time Stamp (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: MPE_TIMESTAMP_TYPE
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPESASA table

IMPESASS-LASTCHANGEDATETIME table field - UTC Time Stamp (YYYYMMDDhhmmss)

Description: UTC Time Stamp (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: MPE_TIMESTAMP_TYPE
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPESASS table

IOMTEXTT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IOMTEXTT table

IPCEVENT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCEVENT table

IPMRPSIM-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: PMRP_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMRPSIM table

IPPMTASK-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMTASK table

IPPMTHIS-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMTHIS table

IPRATPTL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATPTL table

IPRATVTL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATVTL table

IPRODUCT-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRODUCT table

ISHCHGOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISHCHGOP table

ISHRPROD-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISHRPROD table

ISITNDEF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISITNDEF table

ISRCSLTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRCSLTP table

ISUPPROT-LASTCHANGEDATETIME table field - Changed On / At

Description: Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: SUP_LAST_CHANGE_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPROT table

ITRDCLSN-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITRDCLSN table

MASSEKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MASSEKKO table

MPE_ST_D-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPE_ST_D table

MPE_WI_D-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPE_WI_D table

OVDCVC_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OVDCVC_D table

PINCINVP-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PINCINVP table

PLMROUTE-LASTCHANGEDATETIME table field - Timestamp

Description: Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LMD_COM_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PLMROUTE table

PLMZ_ARC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PLMZ_ARC table

PMMO_NHA-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMMO_NHA table

PSFORMTP-LASTCHANGEDATETIME table field - Last Changed Timestamp

Description: Last Changed Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PS_LAST_CHANGED_DATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSFORMTP table

P_ASGDOC-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP P_ASGDOC table

P_REFDOC-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP P_REFDOC table

RFM_GR_D-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_DOC_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RFM_GR_D table

RHRRPDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RHRRPDIR table

TXI_KBLK-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP TXI_KBLK table

VEINAREG-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VEINAREG table

VICNCN_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VICNCN_D table

WB2_EKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WB2_EKKO table

WB2_RBKP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WB2_RBKP table

WRFSTPOB-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WRFSTPOB table

ALLOCTAGT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ALLOCTAGT table

APASQNCTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APASQNCTP table

APIJITHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APIJITHDR table

APROCORD2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APROCORD2 table

APURGSRCE-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APURGSRCE table

ARUN_RULE-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ARUN_RULE table

ATPSOTDEF-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: ATP_SOT_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ATPSOTDEF table

CARUNRULE-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CARUNRULE table

CCA_BIP_H-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCA_BIP_H table

CCHGRECTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECTP table

CCNTXIIPT-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTXIIPT table

CCRRBCTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRBCTTP table

CEPDEMLIN-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEPDEMLIN table

CJITCHDTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITCHDTP table

CMMRFQENH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMRFQENH table

CPCTASKTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCTASKTP table

CPPMGAPMS-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMGAPMS table

CPPMGAPPR-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMGAPPR table

CSUPLRLTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSUPLRLTP table

CWCBCCOPG-LASTCHANGEDATETIME table field - UTC Time Stamp of Last Condition Contract Change

Description: UTC Time Stamp of Last Condition Contract Change
Field Name: LASTCHANGEDATETIME
Data Element: WCB_CHANGED_ON_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CWCBCCOPG table

EHFNDD_WV-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDD_WV table

EHFNDV_CP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_CP table

EHFNDW_CP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDW_CP table

EKKO_LINE-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EKKO_LINE table

ETO_PROBJ-LASTCHANGEDATETIME table field - Change Time Stamp (ETO Process Object)

Description: Change Time Stamp (ETO Process Object)
Field Name: LASTCHANGEDATETIME
Data Element: ETO_PROBJ_CHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ETO_PROBJ table

IABAGTHAZ-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABAGTHAZ table

IABAGTREV-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABAGTREV table

IADEFROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IADEFROOT table

IAHFTHSEQ-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IAHFTHSEQ table

IALLWNCDG-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLWNCDG table

IALTVCTRL-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALTVCTRL table

IARUNRULE-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IARUNRULE table

IBOMCOMPS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMCOMPS table

IBSPENHCD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBSPENHCD table

ICDEFRESH-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICDEFRESH table

ICHEMICAL-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHEMICAL table

ICHMBINFO-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMBINFO table

ICHMHCEWG-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMHCEWG table

ICHMHCLSS-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMHCLSS table

ICHMHSTMT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMHSTMT table

ICHMRSEWG-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHMRSEWG table

ICHPLTRES-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLTRES table

ICNTRLQTN-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTRLQTN table

ICNTXIIPT-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXIIPT table

ICPACTVTN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPACTVTN table

ICRRARMTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMTP table

ICRRBCTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCTTP table

ICRRDGLBL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGLBL table

ICRRDGMOT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGMOT table

ICRRESULT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRESULT table

ICRRFAMTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMTP table

ICRRFFMTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMTP table

ICRRHZITP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZITP table

ICRROELTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRROELTP table

ICRRPPMTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMTP table

ICRRSDSTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSDSTP table

ICTRLGRPG-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICTRLGRPG table

IEMBOAWID-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEMBOAWID table

IETOPROBJ-LASTCHANGEDATETIME table field - Change Time Stamp (ETO Process Object)

Description: Change Time Stamp (ETO Process Object)
Field Name: LASTCHANGEDATETIME
Data Element: ETO_PROBJ_CHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IETOPROBJ table

IEWMHUHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMHUHDR table

IEWMINBBP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMINBBP table

IEWMODOBP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMODOBP table

IEWMTUACT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SCWM/DE_CHANGED_TSTMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMTUACT table

IFIXASSET-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIXASSET table

IFLOCTEXT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFLOCTEXT table

IFUNDEDPH-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFUNDEDPH table

IGLACCTCY-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IGLACCTCY table

IINCASINV-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCASINV table

IINCBINFA-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCBINFA table

IINCIDENT-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCIDENT table

IINCINCGR-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCINCGR table

IINCINJIL-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCINJIL table

IINCINJPI-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCINJPI table

IINCINRES-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCINRES table

IINCINSTP-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCINSTP table

IINCRCAUS-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCRCAUS table

IINCRELEX-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCRELEX table

IINCRESDU-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCRESDU table

IINCTIDAT-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCTIDAT table

IINCVEHIC-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCVEHIC table

IINCVIOLN-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCVIOLN table

IISSRVCCD-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IISSRVCCD table

IITRLCLIC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IITRLCLIC table

IJITPGDEF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITPGDEF table

IJITSCHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITSCHDR table

IKBOMITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IKBOMITEM table

ILISUROOT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISUROOT table

ILOCATION-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILOCATION table

ILOCNAMET-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILOCNAMET table

IMAKEBTDF-LASTCHANGEDATETIME table field - Creation Date and Time

Description: Creation Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FARP_PRQ_CR_DATE
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAKEBTDF table

IMDEFROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDEFROOT table

IMDSUBEXC-LASTCHANGEDATETIME table field - Substitution Last Changed Date

Description: Substitution Last Changed Date
Field Name: LASTCHANGEDATETIME
Data Element: MD_SUBSTN_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDSUBEXC table

IMDSUBGRP-LASTCHANGEDATETIME table field - Substitution Last Changed Date

Description: Substitution Last Changed Date
Field Name: LASTCHANGEDATETIME
Data Element: MD_SUBSTN_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDSUBGRP table

IMDSUBRSN-LASTCHANGEDATETIME table field - Substitution Last Changed Date

Description: Substitution Last Changed Date
Field Name: LASTCHANGEDATETIME
Data Element: MD_SUBSTN_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDSUBRSN table

IMMQTNENH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMQTNENH table

IMMRFQENH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMRFQENH table

IMPEASWDR-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEASWDR table

IMPEOAICA-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOAICA table

IMPESASAA-LASTCHANGEDATETIME table field - UTC Time Stamp (YYYYMMDDhhmmss)

Description: UTC Time Stamp (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: MPE_TIMESTAMP_TYPE
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPESASAA table

IMWCORDOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMWCORDOP table

INGCCLFN8-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INGCCLFN8 table

INGCCLFN9-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INGCCLFN9 table

IPACTLGTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPACTLGTP table

IPASQNCTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPASQNCTP table

IPCPHRSDR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRSDR table

IPCTASKTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCTASKTP table

IPOACSOTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPOACSOTP table

IPPMGHARV-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGHARV table

IPPMTPYTR-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMTPYTR table

IPRATCATL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATCATL table

IPUCAPI01-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPUCAPI01 table

IRPRPARAM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: /PLMB/RCP_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRPRPARAM table

IRUFINCNT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRUFINCNT table

ISASSETTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISASSETTP table

ISBATCHTP-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISBATCHTP table

ISCHEDOPS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISCHEDOPS table

ISDEFHEAD-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDEFHEAD table

ISDEFROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDEFROOT table

ISDEFSAMP-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDEFSAMP table

ISITNINST-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISITNINST table

ISLCQNAIR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISLCQNAIR table

ISPRODDIT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODDIT table

ISRCSLIST-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRCSLIST table

ISUBSTRAT-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUBSTRAT table

ISUPLRLTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPLRLTP table

IVCHODBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IVCHODBSC table

IWORKPCKG-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWORKPCKG table

IWORKVIEW-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWORKVIEW table

MASS_EINA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MASS_EINA table

MASS_EKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MASS_EKKO table

MEPI_EBAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MEPI_EBAN table

MMSRCSL_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSRCSL_D table

MPE_CER_T-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPE_CER_T table

MSR_S_RPO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MSR_S_RPO table

NJIT_HD_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP NJIT_HD_D table

PALLOCOBJ-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PALLOCOBJ table

PCNTXIIPT-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCNTXIIPT table

PFIXASSET-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFIXASSET table

PMWCORDOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMWCORDOP table

PREQ_ITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PREQ_ITEM table

PROD_ROOT-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PROD_ROOT table

RBKP_DATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RBKP_DATA table

RCGBOMPOS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RCGBOMPOS table

RCNTRLQTN-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RCNTRLQTN table

RMXMS_BOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RMXMS_BOM table

ROIGSIH_W-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ROIGSIH_W table

SIT_D_DEF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SIT_D_DEF table

TXI_HDRTP-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP TXI_HDRTP table

ABCALTCNTL-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABCALTCNTL table

APRODNORD2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APRODNORD2 table

APURGCATRT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APURGCATRT table

APURINFREC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APURINFREC table

ARUNRULE_D-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ARUNRULE_D table

ASUPLRACTY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASUPLRACTY table

AUFK_DRAFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP AUFK_DRAFT table

CALLWNCDTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALLWNCDTP table

CBDOCF0797-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CBDOCF0797 table

CCHARCCTLG-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHARCCTLG table

CCM_HEADER-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCM_HEADER table

CCONTRWFIN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCONTRWFIN table

CEXTPRITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEXTPRITEM table

CMIG_HEADS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMIG_HEADS table

CMIG_ITEMS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMIG_ITEMS table

CNTRLQTN_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CNTRLQTN_D table

COVDACCESS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COVDACCESS table

CPCEVENTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCEVENTTP table

CPCHIERHDR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCHIERHDR table

CPDGCCBRTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPDGCCBRTP table

CPDGCTBRTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPDGCTBRTP table

CSCHEDDSPT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSCHEDDSPT table

CSHPDSRCSH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSHPDSRCSH table

CSHRPRODTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSHRPRODTP table

CSITNDEFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSITNDEFTP table

CTRDCMPLTP-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CTRDCMPLTP table

DMF_S_WRF1-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP DMF_S_WRF1 table

EHFNDD_USE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDD_USE table

EHFNDV_CRR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_CRR table

EHFNDV_PCE-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_PCE table

EHFNDV_PCT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_PCT table

EHFNDV_USE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_USE table

EHFNDW_CRR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDW_CRR table

EHFNDW_HZI-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDW_HZI table

EHFNDW_USE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDW_USE table

ESO_S_EINA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESO_S_EINA table

EXTREQBANF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EXTREQBANF table

FNDEIFEBAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FNDEIFEBAN table

FNDEIFEINA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FNDEIFEINA table

FNDEIFEKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FNDEIFEKKO table

FNDEIFRBKP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FNDEIFRBKP table

HEADER_BOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP HEADER_BOM table

IABAGTROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABAGTROOT table

IABAPCSSTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABAPCSSTP table

IACTLOGPRD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IACTLOGPRD table

IADBKFCUBE-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IADBKFCUBE table

IALLWNCDGT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLWNCDGT table

IALLWNCDTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLWNCDTP table

IBOMHEADER-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMHEADER table

IBOMITEMTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMITEMTP table

IBSPSCITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBSPSCITEM table

ICCGLACCHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCGLACCHD table

ICHPLPARAM-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAM table

ICHPLTSERV-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLTSERV table

ICLINVPRST-LASTCHANGEDATETIME table field - Last changed at

Description: Last changed at
Field Name: LASTCHANGEDATETIME
Data Element: UDM_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICLINVPRST table

ICMREQUEST-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: CHGMGMTLASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMREQUEST table

ICNTRLPCON-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTRLPCON table

ICPURORDTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPURORDTP table

ICRRARMREF-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMREF table

ICRRBCTDET-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCTDET table

ICRRBCTDSC-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCTDSC table

ICRRDGPLBL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGPLBL table

ICRRFAMEYE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMEYE table

ICRRFAMINF-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMINF table

ICRRFAMING-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMING table

ICRRPPMEYE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMEYE table

ICRRPPMGEN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMGEN table

ICRRSARATP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSARATP table

ICRRSDSDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSDSDOC table

ICRRSTCLTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSTCLTP table

ICRVACTVTN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRVACTVTN table

ICRVGRPASS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRVGRPASS table

ICURRABAGT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICURRABAGT table

IDDPIRHIST-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDDPIRHIST table

IDDPRODUCT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDDPRODUCT table

IDDSTBUFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDDSTBUFTP table

IEHSAMNHIS-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSAMNHIS table

IEHSRSKIMP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRSKIMP table

IEHSRSKREV-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRSKREV table

IEHSRSKTMP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRSKTMP table

IENGSNPHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENGSNPHDR table

IEQUIPMENT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEQUIPMENT table

IEWMODOHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEWMODOHDR table

IFIFINSSKF-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIFINSSKF table

IJITDSGHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITDSGHDR table

IKBOMAPITP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IKBOMAPITP table

ILISUGROUP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISUGROUP table

ILISUNAMET-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ILISUNAMET table

IMAINTITEM-LASTCHANGEDATETIME table field - Time Stamp for BI Delta Extraction

Description: Time Stamp for BI Delta Extraction
Field Name: LASTCHANGEDATETIME
Data Element: TSTMP_BW_EXT
Data Type: DEC
length (Dec): 16(0)
Check table:
Conversion Routine:
Domain Name: RKE_TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTITEM table

IMAINTPLAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTPLAN table

IMDEFROOTB-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDEFROOTB table

IMDSUBCTRL-LASTCHANGEDATETIME table field - Substitution Last Changed Date

Description: Substitution Last Changed Date
Field Name: LASTCHANGEDATETIME
Data Element: MD_SUBSTN_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMDSUBCTRL table

IMPEOATEXT-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOATEXT table

INFORECROW-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INFORECROW table

INGCCLFN10-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INGCCLFN10 table

INGCCLFN11-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INGCCLFN11 table

INGCCLFN12-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INGCCLFN12 table

INGCCLFN16-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INGCCLFN16 table

IORGMFAREA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IORGMFAREA table

IOVDACCESS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IOVDACCESS table

IOVDCCOMBN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IOVDCCOMBN table

IPALLOCOBJ-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPALLOCOBJ table

IPCEVENTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCEVENTTP table

IPCPHRSASS-LASTCHANGEDATETIME table field - OBSOLETE Date and Time of Last Change

Description: OBSOLETE Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_PHRS_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRSASS table

IPCPHRSFLD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRSFLD table

IPCPHRSTXT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRSTXT table

IPCUSEDRFT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCUSEDRFT table

IPOCONRULE-LASTCHANGEDATETIME table field - Changed Date Time

Description: Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_POCONS_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPOCONRULE table

IPPMGAGDBD-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGDBD table

IPPMGAGRDB-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGRDB table

IPPMGPRDHS-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGPRDHS table

IPPMGPRDSS-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGPRDSS table

IPPPSAADTP-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PK_LASTCHANGE_DATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPPSAADTP table

IPRATPSCEN-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATPSCEN table

IPRATPTLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATPTLTP table

IPRATVSCEN-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATVSCEN table

IPRATVTLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATVTLTP table

IPURGCATRT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURGCATRT table

IPURINFREC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURINFREC table

ISCHEDWLOP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISCHEDWLOP table

ISDSLSINQY-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDSLSINQY table

ISDSLSPLAN-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDSLSPLAN table

ISDSLSQTAN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDSLSQTAN table

ISHRPRODTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISHRPRODTP table

ISITNDEFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISITNDEFTP table

ISPRODSPEC-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODSPEC table

ISUPFLEXTB-LASTCHANGEDATETIME table field - Changed On / At

Description: Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: SUP_LAST_CHANGE_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPFLEXTB table

ISUPLRACTY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPLRACTY table

ISUPLRLIST-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPLRLIST table

ISUPPROTCC-LASTCHANGEDATETIME table field - Changed On / At

Description: Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: SUP_LAST_CHANGE_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPROTCC table

ISUPPROTTB-LASTCHANGEDATETIME table field - Changed On / At

Description: Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: SUP_LAST_CHANGE_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPROTTB table

ITRDCMPLTP-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITRDCMPLTP table

IWPUNITKPI-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWPUNITKPI table

IWSTSTREAM-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWSTSTREAM table

KBLD_PRINT-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP KBLD_PRINT table

MASSEKKO_A-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MASSEKKO_A table

MEPOHEADER-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MEPOHEADER table

MEREQ_ITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MEREQ_ITEM table

MMPURSPAWD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMPURSPAWD table

MMQTNENH_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMQTNENH_D table

MMRFQENH_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMRFQENH_D table

MMSRCGPNGN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSRCGPNGN table

MMSRCGPROJ-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSRCGPROJ table

MMSRCSLIST-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSRCSLIST table

MPEV_CER_T-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPEV_CER_T table

OFI_CNFG_H-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OFI_CNFG_H table

OVDCOMBN_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OVDCOMBN_D table

PALLOCOBJD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PALLOCOBJD table

PBOMHEADER-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PBOMHEADER table

PBPUPERSON-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PBPUPERSON table

PEPROLEMIG-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PEPROLEMIG table

PGLACCOUNT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGLACCOUNT table

PMMO_STOCK-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMMO_STOCK table

PNGCCLFN25-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PNGCCLFN25 table

PPCTSKCAST-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPCTSKCAST table

PPPMGAGDBD-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPPMGAGDBD table

PSPRODSPEC-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSPRODSPEC table

PURGDOCROW-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PURGDOCROW table

PURGORDROW-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PURGORDROW table

PURORDTP_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PURORDTP_D table

RCGBOMHEAD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RCGBOMHEAD table

RCNTRLPCON-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RCNTRLPCON table

RMAINTPFTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: DFS_CHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RMAINTPFTP table

RORITEMRAP-LASTCHANGEDATETIME table field - Last Change Date/Time

Description: Last Change Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: APOC_LCHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RORITEMRAP table

SIT2_D_DEF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SIT2_D_DEF table

SIT_D_INST-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SIT_D_INST table

UNIALLOT_D-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP UNIALLOT_D table

VICDCOND_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VICDCOND_D table

VPALLOCOBJ-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VPALLOCOBJ table

ACNTRLPCTRH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACNTRLPCTRH table

ACSMATGRPHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSMATGRPHD table

AENGPROJECT-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP AENGPROJECT table

APLNDORDCAP-LASTCHANGEDATETIME table field - Last Change to Planned Order: Time Stamp

Description: Last Change to Planned Order: Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PSTMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APLNDORDCAP table

APROCNORDOP-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APROCNORDOP table

APROCORDOP2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APROCORDOP2 table

APRODNORDOP-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APRODNORDOP table

ARUNRCVAR_D-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RC_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ARUNRCVAR_D table

ASALESORDER-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASALESORDER table

ASOWTHOCHRG-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASOWTHOCHRG table

ATPSOTDEF_D-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: ATP_SOT_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ATPSOTDEF_D table

ATP_BOP_CSS-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ATP_BOP_CSS table

ATP_BOP_SEG-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ATP_BOP_SEG table

CACPPMGPART-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CACPPMGPART table

CALLWNCDGTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALLWNCDGTP table

CALTVCTRLTP-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALTVCTRLTP table

CARPOSTRLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CARPOSTRLTP table

CBATCHCERTI-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CBATCHCERTI table

CCHPLTRESTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLTRESTP table

CCM_BOMDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCM_BOMDATA table

CCNTRLQTNTP-LASTCHANGEDATETIME table field - Last Changed Date and Time

Description: Last Changed Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LAST_CHANGE_DATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTRLQTNTP table

CCNTXIIPTTP-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTXIIPTTP table

CCRRHISTORY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRHISTORY table

CCUSTPROJWL-LASTCHANGEDATETIME table field - Time stamp of change

Description: Time stamp of change
Field Name: LASTCHANGEDATETIME
Data Element: TSTMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCUSTPROJWL table

CCUSTRETOPG-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCUSTRETOPG table

CENGSNPEBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENGSNPEBOM table

CETOPROBJTP-LASTCHANGEDATETIME table field - Change Time Stamp (ETO Process Object)

Description: Change Time Stamp (ETO Process Object)
Field Name: LASTCHANGEDATETIME
Data Element: ETO_PROBJ_CHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CETOPROBJTP table

CJITSCHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITSCHDRTP table

CLMROUTEDEX-LASTCHANGEDATETIME table field - Timestamp

Description: Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LMD_COM_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CLMROUTEDEX table

CMMPRITMDEX-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMPRITMDEX table

CNTRLPCTP_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CNTRLPCTP_D table

COUTREQITEM-LASTCHANGEDATETIME table field - Last Change Date/Time

Description: Last Change Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: APOC_LCHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COUTREQITEM table

CPCSRREQSDS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCSRREQSDS table

CPMRPCHGHIS-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPMRPCHGHIS table

CPROJTEAMCD-LASTCHANGEDATETIME table field - Change Document (Created On)

Description: Change Document (Created On)
Field Name: LASTCHANGEDATETIME
Data Element: CDCREATED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPROJTEAMCD table

CPTXHISTORY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPTXHISTORY table

CPURORDTP_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPURORDTP_D table

CRUFINCNTTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRUFINCNTTP table

CSITN2DEFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSITN2DEFTP table

CSPRODDITTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSPRODDITTP table

CSRCGPROJVB-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSRCGPROJVB table

CSRCSLISTTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSRCSLISTTP table

DPIDOCDRAFT-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PI_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP DPIDOCDRAFT table

EAM_PLNGBKT-LASTCHANGEDATETIME table field - Date and time the planning bucket was last changed

Description: Date and time the planning bucket was last changed
Field Name: LASTCHANGEDATETIME
Data Element: EAM_LASTCHANGEDAT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EAM_PLNGBKT table

EHFNDD_PHRS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDD_PHRS table

EHFNDW_PHRS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDW_PHRS table

ETO_PROBJ_D-LASTCHANGEDATETIME table field - Change Time Stamp (ETO Process Object)

Description: Change Time Stamp (ETO Process Object)
Field Name: LASTCHANGEDATETIME
Data Element: ETO_PROBJ_CHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ETO_PROBJ_D table

FAAVASSETS4-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAAVASSETS4 table

FAP_PAYPLAN-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FAP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAP_PAYPLAN table

FINS_CLS_WL-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FINS_CLS_WL table

FIN_RE_RULE-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FIN_RE_RULE table

IACPPMGPART-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IACPPMGPART table

IALLWNCDGTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLWNCDGTP table

IALTVCTRLTP-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALTVCTRLTP table

IARPOSTRULE-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IARPOSTRULE table

IARUNRULETP-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IARUNRULETP table

IATPRESPYTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IATPRESPYTP table

IBATCHPLANT-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBATCHPLANT table

IBOMDETAILS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMDETAILS table

IBOMHEADDET-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMHEADDET table

IBOMITEMSTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMITEMSTP table

IBOOVERSION-LASTCHANGEDATETIME table field - Task List Version: Last Change Time Stamp

Description: Task List Version: Last Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PLNVERSN_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOOVERSION table

IBSPSBCITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBSPSBCITEM table

IBSPSLOITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBSPSLOITEM table

IBSPSVOITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBSPSVOITEM table

ICA_BIP_HTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICA_BIP_HTP table

ICHGRECDBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHGRECDBSC table

ICHPLASSIGN-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLASSIGN table

ICHPLCOUNTR-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLCOUNTR table

ICHPLTRESTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLTRESTP table

ICMACTIVITY-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: CHGMGMTLASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMACTIVITY table

ICMPLNCPRPS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMPLNCPRPS table

ICNTRLQTNTP-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTRLQTNTP table

ICNTXIIPTTP-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXIIPTTP table

ICNTXISTSLG-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXISTSLG table

ICPACASSIGN-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPACASSIGN table

ICPACTVTNTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPACTVTNTP table

ICPCRASSGMT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPCRASSGMT table

ICRRARMENVP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMENVP table

ICRRARMPPEP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMPPEP table

ICRRDGLBLTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGLBLTP table

ICRRDGMOTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGMOTTP table

ICRRDGNOTES-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGNOTES table

ICRREFINPTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFINPTP table

ICRREFMRCTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFMRCTP table

ICRRESULTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRESULTTP table

ICRRFAMASMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMASMT table

ICRRFAMINHL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMINHL table

ICRRFAMPROT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMPROT table

ICRRFAMSKIN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMSKIN table

ICRRFFMASMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMASMT table

ICRRFFMHZRD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMHZRD table

ICRRFFMMTHD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMMTHD table

ICRRHZISUBD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZISUBD table

ICRROELCOMP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRROELCOMP table

ICRRPPMASMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMASMT table

ICRRPPMFLTR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMFLTR table

ICRRPPMHAND-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMHAND table

ICRRPPMRSPR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMRSPR table

ICRRPPMSKIN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMSKIN table

ICRRSARACAT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSARACAT table

ICRRSDSCTRY-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSDSCTRY table

ICSHPOSPRFL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSHPOSPRFL table

ICSMATGRPHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSMATGRPHD table

IDGDEPCLANG-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDGDEPCLANG table

IDGDSTCLANG-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDGDSTCLANG table

IDGREGCLANG-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDGREGCLANG table

IDOCGRPRULE-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_DOC_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDOCGRPRULE table

IEHSAMNROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSAMNROOT table

IEHSJOBROOT-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSJOBROOT table

IEHSPMTDESC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSPMTDESC table

IEHSRASRISK-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRASRISK table

IEHSRASROOT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRASROOT table

IEHSRSKCTRL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRSKCTRL table

IENGMNTPROJ-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENGMNTPROJ table

IENGSNPEBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENGSNPEBOM table

IENTPROJENT-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENTPROJENT table

IEPFINANPLN-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEPFINANPLN table

IEPRJOBJLNK-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: TV_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEPRJOBJLNK table

IEPWORKPCKG-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEPWORKPCKG table

IETOPROBJTP-LASTCHANGEDATETIME table field - Change Time Stamp (ETO Process Object)

Description: Change Time Stamp (ETO Process Object)
Field Name: LASTCHANGEDATETIME
Data Element: ETO_PROBJ_CHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IETOPROBJTP table

IEXPLASMMOD-LASTCHANGEDATETIME table field - Date and Time on Which the Object Was Last Changed

Description: Date and Time on Which the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: RFM_ASM_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEXPLASMMOD table

IEXTASMNAME-LASTCHANGEDATETIME table field - Date and Time on Which the Object Was Last Changed

Description: Date and Time on Which the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: RFM_ASM_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEXTASMNAME table

IFCDFMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFCDFMTVERS table

IFIGLGRPCOA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLGRPCOA table

IFIXASSETUO-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIXASSETUO table

IFMCFMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFMCFMTVERS table

IFMDFMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFMDFMTVERS table

IFMEFMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFMEFMTVERS table

IFQMFLOWBAS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFQMFLOWBAS table

IGHOPNLABEL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IGHOPNLABEL table

IIENTERPROJ-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IIENTERPROJ table

IINCPERROLE-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IINCPERROLE table

IJITCALLDOC-LASTCHANGEDATETIME table field - Last Changed Date/Time

Description: Last Changed Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: NJIT_LAST_CHG_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCALLDOC table

IJITCALLHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITCALLHDR table

IJITDCNFHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITDCNFHDR table

IJITOUTBHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITOUTBHDR table

IJITPGDEFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITPGDEFTP table

IJITSCHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITSCHDRTP table

IMAINTNOTIF-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTNOTIF table

IMAINTORDER-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTORDER table

IMEMORECORD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMEMORECORD table

IMMQTNAPI01-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMQTNAPI01 table

IMMRFQAPI01-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMRFQAPI01 table

IMMRFQENHWD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMRFQENHWD table

IMMSESAPI01-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMSESAPI01 table

IMMSEVCRITC-LASTCHANGEDATETIME table field - Date Evaluation Score Was Last Changed

Description: Date Evaluation Score Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: MM_PUR_ANA_DE_SEWS_DATETIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMSEVCRITC table

IMNTJOBPCKG-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMNTJOBPCKG table

IMPEOANTEXT-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOANTEXT table

IMPERSNCGRP-LASTCHANGEDATETIME table field - System Date on Which Data Record Was Changed

Description: System Date on Which Data Record Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: QDATUMAEND
Data Type: DATS
length (Dec): 8(0)
Check table:
Conversion Routine:
Domain Name: DATUM
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPERSNCGRP table

IMPESASSCHE-LASTCHANGEDATETIME table field - UTC Time Stamp (YYYYMMDDhhmmss)

Description: UTC Time Stamp (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: MPE_TIMESTAMP_TYPE
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPESASSCHE table

IMPPRSRCITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPPRSRCITM table

IORGMAREABA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IORGMAREABA table

IOUTREQITEM-LASTCHANGEDATETIME table field - Last Change Date/Time

Description: Last Change Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: APOC_LCHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IOUTREQITEM table

IPCRESTRUSE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCRESTRUSE table

IPCSPCFCUSE-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCSPCFCUSE table

IPHDCASSGMT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPHDCASSGMT table

IPPAGRDISTR-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPAGRDISTR table

IPPKANBANCC-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPKANBANCC table

IPPMGAGCDTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGCDTP table

IPPMGAGCNTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGCNTP table

IPPMGAPMSTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAPMSTP table

IPPMGAPPDOC-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAPPDOC table

IPPMGAPPDTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAPPDTP table

IPPMGAPPRTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAPPRTP table

IPPMGHARVTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGHARVTP table

IPPMPROJECT-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMPROJECT table

IPRATCASCEN-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATCASCEN table

IPRATCATLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATCATLTP table

IPRCFIXOPTN-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRCFIXOPTN table

IPRITMAPI01-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRITMAPI01 table

IPROJTEAMCD-LASTCHANGEDATETIME table field - Change Document (Created On)

Description: Change Document (Created On)
Field Name: LASTCHANGEDATETIME
Data Element: CDCREATED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPROJTEAMCD table

IPUBSECFORM-LASTCHANGEDATETIME table field - Last Changed Timestamp

Description: Last Changed Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PS_LAST_CHANGED_DATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPUBSECFORM table

IPURGQTAHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURGQTAHDR table

IPURREQNITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQNITM table

IPURREQWITP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQWITP table

IRENEGOLIST-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRENEGOLIST table

IREPLDPOENH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IREPLDPOENH table

IRUFINCNTTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRUFINCNTTP table

ISADDRESSTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISADDRESSTP table

ISASSETTP_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISASSETTP_D table

ISBATCHTP_D-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISBATCHTP_D table

ISCCHKDGRTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_DOC_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISCCHKDGRTP table

ISCSTRTSWTP-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOFU/TSTMP_CHANGED_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOFU/TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISCSTRTSWTP table

ISDSALESDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDSALESDOC table

ISDSOIMPORT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDSOIMPORT table

ISITNINSTTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISITNINSTTP table

ISPRODDITTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODDITTP table

ISPRODUCTWD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODUCTWD table

ISSOMU_LOGO-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISSOMU_LOGO table

ISSOMU_TEXT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISSOMU_TEXT table

ISUBSTRATTP-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUBSTRATTP table

ISUPPLCONFH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPLCONFH table

ISUPPLCONFI-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPLCONFI table

ISUPPROTGRP-LASTCHANGEDATETIME table field - Changed On / At

Description: Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: SUP_LAST_CHANGE_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPROTGRP table

ISUPPROTPCP-LASTCHANGEDATETIME table field - Changed On / At

Description: Changed On / At
Field Name: LASTCHANGEDATETIME
Data Element: SUP_LAST_CHANGE_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUPPROTPCP table

ITEAMHEADER-LASTCHANGEDATETIME table field - UTC time stamp in long form (YYYYMMDDhhmmss,mmmuuun)

Description: UTC time stamp in long form (YYYYMMDDhhmmss,mmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITEAMHEADER table

ITRADOCMATL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITRADOCMATL table

ITRADOCPART-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITRADOCPART table

ITRDCMPLHDR-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ITRDCMPLHDR table

IWI_PRHDR_D-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWI_PRHDR_D table

MAINTITEM_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MAINTITEM_D table

MASS_EKKO_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MASS_EKKO_D table

MEIRHEADERX-LASTCHANGEDATETIME table field - Updated information in related user data field

Description: Updated information in related user data field
Field Name: LASTCHANGEDATETIME
Data Element: BAPIUPDATE
Data Type: CHAR
length (Dec): 1(0)
Check table:
Conversion Routine:
Domain Name: BAPIUPDATE
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MEIRHEADERX table

MEPOHEADERX-LASTCHANGEDATETIME table field - Updated information in related user data field

Description: Updated information in related user data field
Field Name: LASTCHANGEDATETIME
Data Element: BAPIUPDATE
Data Type: CHAR
length (Dec): 1(0)
Check table:
Conversion Routine:
Domain Name: BAPIUPDATE
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MEPOHEADERX table

MMSUPLRLIST-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSUPLRLIST table

MPE_MRS_OBJ-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPE_MRS_OBJ table

MPOS_MPLA_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPOS_MPLA_D table

MSIT_PIRGEN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MSIT_PIRGEN table

OVDACCESS_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OVDACCESS_D table

PACTLSFOREP-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PACTLSFOREP table

PADBKFCITEM-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PADBKFCITEM table

PAQTYASSGMT-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PAQTYASSGMT table

PAYRQ_DRAFT-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FARP_PRQ_CHG_DATE
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PAYRQ_DRAFT table

PBATCHPLANT-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PBATCHPLANT table

PCNTXISTSLG-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCNTXISTSLG table

PCSHREQFLLW-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCSHREQFLLW table

PCSUNIVHIER-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCSUNIVHIER table

PENGCOCKPIT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PENGCOCKPIT table

PEPRJOBJLNK-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: TV_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PEPRJOBJLNK table

PEQUISEARCH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PEQUISEARCH table

PFFOLBFROOT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFFOLBFROOT table

PFLOCSEARCH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFLOCSEARCH table

PFSIMAPHDRD-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFSIMAPHDRD table

PGLACCTCURR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PGLACCTCURR table

PIFMEGENATT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PIFMEGENATT table

PLMICSTRTHW-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOFU/TSTMP_CHANGED_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOFU/TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PLMICSTRTHW table

PLMICSTRTSW-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOFU/TSTMP_CHANGED_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOFU/TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PLMICSTRTSW table

PMPPRSRCITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMPPRSRCITM table

PORGMAREABA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PORGMAREABA table

POUTREQITEM-LASTCHANGEDATETIME table field - Last Change Date/Time

Description: Last Change Date/Time
Field Name: LASTCHANGEDATETIME
Data Element: APOC_LCHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP POUTREQITEM table

PPPMPROJECT-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPPMPROJECT table

PPROPSTKBUF-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPROPSTKBUF table

PPURREQNITM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPURREQNITM table

PSCHCOPERLC-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 17(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSCHCOPERLC table

PSDMDMDFCTR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSDMDMDFCTR table

PSITADMINST-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSITADMINST table

PTAGTOCYCLE-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PTAGTOCYCLE table

PTEAMHEADER-LASTCHANGEDATETIME table field - UTC time stamp in long form (YYYYMMDDhhmmss,mmmuuun)

Description: UTC time stamp in long form (YYYYMMDDhhmmss,mmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PTEAMHEADER table

RCGBOMPOSWL-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RCGBOMPOSWL table

RPROCMTPROJ-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RPROCMTPROJ table

SLL_LCLIC_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SLL_LCLIC_D table

VBALACCOUNT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VBALACCOUNT table

VFCLMBALDET-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VFCLMBALDET table

WB2_IV_DATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WB2_IV_DATA table

WB2_PO_DATA-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WB2_PO_DATA table

/PLMI/S_MBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP /PLMI/S_MBOM table

/SCMB/S_EKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP /SCMB/S_EKKO table

ABCALTCNTL_D-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABCALTCNTL_D table

ABUSSOLNQTAN-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABUSSOLNQTAN table

ACNTRLPCTRVH-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACNTRLPCTRVH table

AEXCTXCMMDTY-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP AEXCTXCMMDTY table

AFIGLACCTLIT-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP AFIGLACCTLIT table

APALLOCOBJTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APALLOCOBJTP table

APLNDORDCOMP-LASTCHANGEDATETIME table field - Last Change to Planned Order: Time Stamp

Description: Last Change to Planned Order: Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PSTMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APLNDORDCOMP table

APRODNORDOP2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP APRODNORDOP2 table

ARNGRPRULE_D-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ARNGRPRULE_D table

ARNSRTRULE_D-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ARNSRTRULE_D table

ASRVCENTRSHT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASRVCENTRSHT table

CALLOCRUNJEI-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALLOCRUNJEI table

CALLOCRUNRES-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALLOCRUNRES table

CALLOCTAGTTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALLOCTAGTTP table

CALLWNCDGTTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CALLWNCDGTTP table

CASSETVALNTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CASSETVALNTP table

CCHPLTSERVTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLTSERVTP table

CCNTXIIPTBND-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTXIIPTBND table

CCRRBCTDSCTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRBCTDSCTP table

CCRRCCISCCTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRCCISCCTP table

CCRRCCISLITP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRCCISLITP table

CCRROELASSMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRROELASSMT table

CCRRSLIEXMTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRSLIEXMTP table

CCRRSLIOSMTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRSLIOSMTP table

CENTPROJMCHG-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENTPROJMCHG table

CFIGLITMCMPQ-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFIGLITMCMPQ table

CJITDSGHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITDSGHDRTP table

CMATERIALBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMATERIALBOM table

CMFGWORKINST-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMFGWORKINST table

CNOSAFTJITMC-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 19(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CNOSAFTJITMC table

CNOSAFTJITMQ-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 19(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CNOSAFTJITMQ table

COVDCCOMBNVH-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COVDCCOMBNVH table

CPACTLG_PATH-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPACTLG_PATH table

CPAOBJASSGWD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPAOBJASSGWD table

CPAOBJCONFWD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPAOBJCONFWD table

CPASQNCMNGWD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPASQNCMNGWD table

CPCETASKINFO-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCETASKINFO table

CPCSRHISTORY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCSRHISTORY table

CPPBRTRDISTR-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPBRTRDISTR table

CPPMASNDOCTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMASNDOCTP table

CPPMGAGPLNTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMGAGPLNTP table

CPPMGAGRMTTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMGAGRMTTP table

CPPMGAGRNTTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMGAGRNTTP table

CPPMGATACHTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMGATACHTP table

CPPMLNKDDDOC-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMLNKDDDOC table

CPPMPRDHISTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMPRDHISTP table

CPPMSLSHISTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMSLSHISTP table

CPPMTLINKAGE-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMTLINKAGE table

CRMS4D_BSP_H-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRMS4D_BSP_H table

CRMS4IUVCPRD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRMS4IUVCPRD table

CRMS4IUVIPRD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRMS4IUVIPRD table

CRRFAMASMTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRRFAMASMTTP table

CRSKIDTMPLTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRSKIDTMPLTP table

CSCHEDAGRHDR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSCHEDAGRHDR table

CSCHPRODNOPS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSCHPRODNOPS table

CSPRODCHRGTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSPRODCHRGTP table

CSPRODDISCTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSPRODDISCTP table

CSPRODSPECTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSPRODSPECTP table

CUNIALLOCTAG-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUNIALLOCTAG table

CUPDGCLFNADG-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNADG table

CUPDGCLFNADN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNADN table

CUPDGCLFNADR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNADR table

CUPDGCLFNCFR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNCFR table

CUPDGCLFNNCH-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNNCH table

CUPDGCLFNNOM-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNNOM table

CUPDGCLFNNZS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNNZS table

CUPDGCLFNRID-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNRID table

CUPDGCLFNTDG-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNTDG table

DDSTKBUFTP_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP DDSTKBUFTP_D table

DFS_PLTFRM_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: DFS_CHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP DFS_PLTFRM_D table

EAMS_S_BO_PR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EAMS_S_BO_PR table

EAMS_S_SP_PR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EAMS_S_SP_PR table

EHDGMD_TNAME-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHDGMD_TNAME table

EHDGMW_TNAME-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHDGMW_TNAME table

EHFNDD_GRPHC-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDD_GRPHC table

EHFNDV_CP_CR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_CP_CR table

EHFNDV_CRR_U-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDV_CRR_U table

EHFNDW_CP_CR-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHFNDW_CP_CR table

EHPRCS_STPOB-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHPRCS_STPOB table

EHSDSD_CNTCT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHSDSD_CNTCT table

EHSDSW_CNTCT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHSDSW_CNTCT table

FAAD_MD_ROOT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAAD_MD_ROOT table

FAA_S_UO_GFN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAA_S_UO_GFN table

FMEF_WD_KBLK-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FMEF_WD_KBLK table

IABOPSEGMENT-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABOPSEGMENT table

IABOPVARIANT-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABOPVARIANT table

IADUSRDEFSET-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IADUSRDEFSET table

IALLOCRUNRES-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLOCRUNRES table

IALLOCTAGTTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLOCTAGTTP table

IALLWNCDGTTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALLWNCDGTTP table

IALTVCONTROL-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALTVCONTROL table

IALTVCTRLGRP-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALTVCTRLGRP table

IASMDCMODULE-LASTCHANGEDATETIME table field - Date and Time on Which the Object Was Last Changed

Description: Date and Time on Which the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: RFM_ASM_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IASMDCMODULE table

IBOMHEADERTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBOMHEADERTP table

ICCCOUNTRYHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCCOUNTRYHD table

ICCCUSTGRPHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCCUSTGRPHD table

ICCFITPDRAFT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCFITPDRAFT table

ICCPRFTCTRHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCPRFTCTRHD table

ICCPRODUCTHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCPRODUCTHD table

ICCPROJECTHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCPROJECTHD table

ICCRFFMCMBPR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCRFFMCMBPR table

ICCRFFMUNSTB-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCRFFMUNSTB table

ICCRIHIERDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCRIHIERDIR table

ICHGRECORDTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHGRECORDTP table

ICHPLASSIGNT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLASSIGNT table

ICHPLTSERVTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLTSERVTP table

ICMMSAMPGEXT-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFSA_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMMSAMPGEXT table

ICNTRLRFQHDR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTRLRFQHDR table

ICNTXIIPTMNG-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXIIPTMNG table

ICRRARMADINF-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMADINF table

ICRRARMCCLUP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMCCLUP table

ICRRARMREFTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMREFTP table

ICRRBCDSGRTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCDSGRTP table

ICRRBCSGRGRP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCSGRGRP table

ICRRBCTDETTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCTDETTP table

ICRRBCTDSCTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRBCTDSCTP table

ICRRDGHZDLBL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGHZDLBL table

ICRRDGMOTDSC-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGMOTDSC table

ICRRDGPKGLBL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGPKGLBL table

ICRRDGPLBLTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGPLBLTP table

ICRREFEBOMTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFEBOMTP table

ICRREFMRCBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFMRCBSC table

ICRRFAMEYETP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMEYETP table

ICRRFAMINFTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMINFTP table

ICRRFAMINGTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMINGTP table

ICRRFAMTRTMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMTRTMT table

ICRRFFMADINF-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMADINF table

ICRRFFMASMTD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMASMTD table

ICRRFFMEQUIP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMEQUIP table

ICRRFFMSUTBL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMSUTBL table

ICRRHZDSASMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZDSASMT table

ICRRHZIASSMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZIASSMT table

ICRRHZIDRAFT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZIDRAFT table

ICRRHZISUBST-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZISUBST table

ICRROELASSMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRROELASSMT table

ICRRPPMEYETP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMEYETP table

ICRRPPMGENTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMGENTP table

ICRRSDSDOCTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSDSDOCTP table

ICRRSTCLCLFN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSTCLCLFN table

ICRRSUBCHKTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSUBCHKTP table

ICRSCTLGEOAS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRSCTLGEOAS table

ICRSCTLGEOPA-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRSCTLGEOPA table

ICRSCTLGVRSN-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRSCTLGVRSN table

ICRVACTVTNTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRVACTVTNTP table

ICUSTRIFNMBR-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICUSTRIFNMBR table

IDFSMEASUREU-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IDFSMEASUREU table

IEHSAMNSENVL-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSAMNSENVL table

IEHSRSKTMPTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEHSRSKTMPTP table

IENGSNPHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENGSNPHDRTP table

IENTPRJELMCD-LASTCHANGEDATETIME table field - Change Document (Created On)

Description: Change Document (Created On)
Field Name: LASTCHANGEDATETIME
Data Element: CDCREATED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IENTPRJELMCD table

IEXCTXCMMDTY-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IEXCTXCMMDTY table

IFICOSTELMNT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFICOSTELMNT table

IFIGLACCTBAL-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLACCTBAL table

IFIGLACCTLIR-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLACCTLIR table

IFIGLACCTLIT-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLACCTLIT table

IFIGLACCTTRD-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLACCTTRD table

IFIGLOBCOMPH-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFIGLOBCOMPH table

IFINRELOGSET-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFINRELOGSET table

IFME_FMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IFME_FMTVERS table

IICLSUBCLAIM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IICLSUBCLAIM table

IIFMCFMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IIFMCFMTVERS table

IIFMEFMTVERS-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: IFME_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IIFMEFMTVERS table

IIINTPROJDET-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IIINTPROJDET table

IJITDSGHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IJITDSGHDRTP table

IKBOMAPITP_1-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IKBOMAPITP_1 table

IMAINTCMPLNC-LASTCHANGEDATETIME table field - Changed Date and Time

Description: Changed Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTCMPLNC table

IMAINTITEMTP-LASTCHANGEDATETIME table field - Time Stamp for BI Delta Extraction

Description: Time Stamp for BI Delta Extraction
Field Name: LASTCHANGEDATETIME
Data Element: TSTMP_BW_EXT
Data Type: DEC
length (Dec): 16(0)
Check table:
Conversion Routine:
Domain Name: RKE_TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMAINTITEMTP table

IMANTPFBASIC-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: DFS_CHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMANTPFBASIC table

IMATERIALBOM-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMATERIALBOM table

IMEMORECORDT-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMEMORECORDT table

IMFGWORKINST-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMFGWORKINST table

IMMCPURORDER-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMMCPURORDER table

IMPEBOOOPRTA-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEBOOOPRTA table

IMPEOANEVENT-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOANEVENT table

IMPEOANGROUP-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IMPEOANGROUP table

INFREC_HDR_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP INFREC_HDR_D table

IORGMAREAUSR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IORGMAREAUSR table

IPALLOCOBJTP-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPALLOCOBJTP table

IPAQTYASSGMT-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPAQTYASSGMT table

IPCPHRSFLDDR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRSFLDDR table

IPCPHRSTXTDR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPCPHRSTXTDR table

IPIDOCHEADER-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PI_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPIDOCHEADER table

IPMRPFLEXCON-LASTCHANGEDATETIME table field - Last Changed

Description: Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMRP_CHANGED_ON_LONG
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMRPFLEXCON table

IPMRPREFPLAN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: PMRP_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMRPREFPLAN table

IPMRPSIMCHGH-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMRPSIMCHGH table

IPMTAPPLAREA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPMTAPPLAREA table

IPOCONRULETP-LASTCHANGEDATETIME table field - Changed Date Time

Description: Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_POCONS_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPOCONRULETP table

IPPMDOCUMENT-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: /S4PPM/TV_CHANGED_ON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMDOCUMENT table

IPPMGACCLDOC-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGACCLDOC table

IPPMGACCLDTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGACCLDTP table

IPPMGAGGACCL-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGGACCL table

IPPMGAGPLNTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGPLNTP table

IPPMGAGRMTTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGRMTTP table

IPPMGAGRNTTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGRNTTP table

IPPMGAGRPLNT-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAGRPLNT table

IPPMGAPPRDOC-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAPPRDOC table

IPPMGAPPRMSG-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGAPPRMSG table

IPPMGCOLLTRL-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGCOLLTRL table

IPPMGPARTNER-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGPARTNER table

IPPMGPRDHSTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGPRDHSTP table

IPPMGPRDSSTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGPRDSSTP table

IPPMGSURCHRG-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPMGSURCHRG table

IPPPLNDORDER-LASTCHANGEDATETIME table field - Last Change to Planned Order: Time Stamp

Description: Last Change to Planned Order: Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: PSTMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPPPLNDORDER table

IPRATPSCENTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATPSCENTP table

IPRATVSCENTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRATVSCENTP table

IPRITEMAPI01-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRITEMAPI01 table

IPRITEMBASIC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPRITEMBASIC table

IPURCHASECTR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURCHASECTR table

IPURGQAAPI01-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURGQAAPI01 table

IPURREQ_WI_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IPURREQ_WI_D table

IRENEGPRCLOG-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRENEGPRCLOG table

IRESVNDOCHDR-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRESVNDOCHDR table

IRFMSOPMCONF-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRFMSOPMCONF table

IRGTYGRPHCTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRGTYGRPHCTP table

IRUFSITEMVER-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IRUFSITEMVER table

ISARUNRULETP-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISARUNRULETP table

ISASSETTP_DR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISASSETTP_DR table

ISBATCHTP_DR-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: LOBM_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISBATCHTP_DR table

ISCSTRTHDRTP-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOFU/TSTMP_CHANGED_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOFU/TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISCSTRTHDRTP table

ISDBILDOCREQ-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDBILDOCREQ table

ISDMCCMCHGRQ-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDMCCMCHGRQ table

ISDPREBILDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDPREBILDOC table

ISDSLSPLANTP-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISDSLSPLANTP table

ISPRODCHRGTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODCHRGTP table

ISPRODDISCTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODDISCTP table

ISPRODSPECTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISPRODSPECTP table

ISRCGPROJQTN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISRCGPROJQTN table

ISSOMU_TEXTT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISSOMU_TEXTT table

ISTADMINFLDS-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISTADMINFLDS table

ISTOCKHEADER-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISTOCKHEADER table

ISTORESTKADJ-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISTORESTKADJ table

ISUBSCONTRCT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ISUBSCONTRCT table

IUNIALLOCTAG-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IUNIALLOCTAG table

IWORKPCKGALL-LASTCHANGEDATETIME table field - Commercial Project Last Changed On

Description: Commercial Project Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /CPD/CPM_CHANGEDON
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IWORKPCKGALL table

MAINTNOTIF_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MAINTNOTIF_D table

MAINTNTFTO_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MAINTNTFTO_D table

MAINTORDER_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MAINTORDER_D table

MEOUT_HEADER-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MEOUT_HEADER table

MMPROCMTPROJ-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMPROCMTPROJ table

MMPURSPAWD_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMPURSPAWD_D table

MMRENEGOLIST-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMRENEGOLIST table

MMSRCGPROJ_D-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSRCGPROJ_D table

MMSUPLRLBUPA-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MMSUPLRLBUPA table

MPCR_CAUSE_D-LASTCHANGEDATETIME table field - Changed Date and Time

Description: Changed Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPCR_CAUSE_D table

MPEASTPDRAFT-LASTCHANGEDATETIME table field - Reason Code Last Changed Timestamp

Description: Reason Code Last Changed Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_REASON_CODE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPEASTPDRAFT table

MPEV_USER_WC-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPEV_USER_WC table

MPE_CER_E_WC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPE_CER_E_WC table

MPE_ST_VER_D-LASTCHANGEDATETIME table field - MPE Last Change Timestamp

Description: MPE Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: MPE_LCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MPE_ST_VER_D table

MRCHDS_CAT_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MRCHDS_CAT_D table

MSIT_PIRSYNC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP MSIT_PIRSYNC table

OIUTV_CA_TOL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OIUTV_CA_TOL table

OIUTV_PR_TOL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OIUTV_PR_TOL table

OIUTV_VL_TOL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP OIUTV_VL_TOL table

PALLOCRUNRES-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PALLOCRUNRES table

PCNTXIBNDHDR-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCNTXIBNDHDR table

PCNTXIBNDITM-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCNTXIBNDITM table

PCSHFLWCOMBN-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCSHFLWCOMBN table

PCSTRTHWITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCSTRTHWITEM table

PCSTRTSWITEM-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PCSTRTSWITEM table

PEQUIINSTSEG-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PEQUIINSTSEG table

PFQMFLOWCASH-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PFQMFLOWCASH table

PINBDLVHDR01-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PINBDLVHDR01 table

PLMCHGRECD_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PLMCHGRECD_D table

PLMICSTRTHDR-LASTCHANGEDATETIME table field - Changed On

Description: Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOFU/TSTMP_CHANGED_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOFU/TSTMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PLMICSTRTHDR table

PMMO_STOCK_S-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMMO_STOCK_S table

PMMO_TRANSIT-LASTCHANGEDATETIME table field - Date/Time When the Object Was Last Changed

Description: Date/Time When the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: PMMO_LAST_CHANGED_ON_D
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: PMMO_CREATION_DATE_TIME
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMMO_TRANSIT table

PMWCORDCACLF-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PMWCORDCACLF table

PNOTIFSEARCH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PNOTIFSEARCH table

PPAQTYASSGMT-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: PAL_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PPAQTYASSGMT table

PREQORDUNION-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PREQORDUNION table

PRSHSCHEDOPS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PRSHSCHEDOPS table

PSCHPRODNOPS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PSCHPRODNOPS table

PURCTR_HDR_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PURCTR_HDR_D table

PURGQTAHDR_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PURGQTAHDR_D table

PURREQNHDR_D-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP PURREQNHDR_D table

RCNTRLRFQHDR-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RCNTRLRFQHDR table

RFM_GRP_RULE-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: RFM_DOC_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RFM_GRP_RULE table

RFM_SCC_EKKO-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RFM_SCC_EKKO table

RMDSUBCTRLVH-LASTCHANGEDATETIME table field - Substitution Last Changed Date

Description: Substitution Last Changed Date
Field Name: LASTCHANGEDATETIME
Data Element: MD_SUBSTN_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RMDSUBCTRLVH table

RMODPRODSPEC-LASTCHANGEDATETIME table field - Model Product Specification: Last Change Date Time

Description: Model Product Specification: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: MMPUR_MPS_LAST_CHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RMODPRODSPEC table

RPADAMOTDRFT-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP RPADAMOTDRFT table

SDMCC_JOBREQ-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP SDMCC_JOBREQ table

UNI_ALLO_TAG-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: FCO_TAG_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP UNI_ALLO_TAG table

VBACCTSETDET-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VBACCTSETDET table

VIIPOBJECT_D-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VIIPOBJECT_D table

VMP_S_CNGREC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP VMP_S_CNGREC table

V_OFI_CNFG_H-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP V_OFI_CNFG_H table

WRF_SIT_DATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP WRF_SIT_DATA table

ABCALTCNTLGRP-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABCALTCNTLGRP table

ABCALTVCNTL_D-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABCALTVCNTL_D table

ABOPSEGMENT_D-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABOPSEGMENT_D table

ABOPVARIANT_D-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABOPVARIANT_D table

ABUSSOLNORDER-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ABUSSOLNORDER table

ACSCUSTGRPHDE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSCUSTGRPHDE table

ACSTRANTYPDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ACSTRANTYPDIR table

ADEBITMEMOREQ-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ADEBITMEMOREQ table

AFIGLACCINCOA-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP AFIGLACCINCOA table

AFIGLACCOUNTT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP AFIGLACCOUNTT table

API_CITEMDATA-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP API_CITEMDATA table

API_KANBANDEL-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP API_KANBANDEL table

API_PIDOCITEM-LASTCHANGEDATETIME table field - Last Change Timestamp

Description: Last Change Timestamp
Field Name: LASTCHANGEDATETIME
Data Element: PI_LAST_CHANGED
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP API_PIDOCITEM table

ASDBILLINGDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASDBILLINGDOC table

ASUPQUOTATION-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ASUPQUOTATION table

CANTTUPDGCLFN-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CANTTUPDGCLFN table

CARNDMNDGRPRL-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CARNDMNDGRPRL table

CARNDMNDSRTRL-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CARNDMNDSRTRL table

CCHGRECREFINP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFINP table

CCHGRECREFLBL-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFLBL table

CCHGRECREFMRC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHGRECREFMRC table

CCHPLASSIGNTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLASSIGNTP table

CCHPLCOUNTRTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLCOUNTRTP table

CCHPLPARAMATP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLPARAMATP table

CCHPLPARAMDTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLPARAMDTP table

CCHPLPARAMNTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLPARAMNTP table

CCHPLPARAMSTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLPARAMSTP table

CCHPLPARAMTTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCHPLPARAMTTP table

CCMMDTYORDREQ-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCMMDTYORDREQ table

CCNTXITRANSFI-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCNTXITRANSFI table

CCPACASSIGNTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCPACASSIGNTP table

CCRROELCOMPTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRROELCOMPTP table

CCRRSDSCTRYTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCRRSDSCTRYTP table

CCTRLCLBYLANG-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: /SAPSLL/CHTSP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCTRLCLBYLANG table

CCTRLGRPGLANG-LASTCHANGEDATETIME table field - Date and Time When Object Was Changed

Description: Date and Time When Object Was Changed
Field Name: LASTCHANGEDATETIME
Data Element: SLL_LCHGDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CCTRLGRPGLANG table

CDFSPLTFRMREL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: DFS_CHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CDFSPLTFRMREL table

CDGDEPCLANGTP-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CDGDEPCLANGTP table

CDGDSTCLANGTP-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CDGDSTCLANGTP table

CDGREGCLANGTP-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CDGREGCLANGTP table

CENGSNPREFDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CENGSNPREFDOC table

CEXISTPRCPROD-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CEXISTPRCPROD table

CFSITEMMAPHDR-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFSITEMMAPHDR table

CFSWCCAPOVW_D-LASTCHANGEDATETIME table field - Packed field

Description: Packed field
Field Name: LASTCHANGEDATETIME
Data Element: DEC15
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: DEC15
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CFSWCCAPOVW_D table

CJITDCNFHDRTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITDCNFHDRTP table

CJITOUTBCGHTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITOUTBCGHTP table

CJITOUTBSQNCQ-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CJITOUTBSQNCQ table

CMAINTITEMDEX-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMAINTITEMDEX table

CMAINTNOTIFTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMAINTNOTIFTP table

CMAINTPLANDEX-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMAINTPLANDEX table

CMMFDOF_D_FWD-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOF_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMFDOF_D_FWD table

CMMFDOR_D_BKT-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMFDOR_D_BKT table

CMMFDOR_D_DOC-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMFDOR_D_DOC table

CMMFDOR_D_LEG-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMMFDOR_D_LEG table

CMPSTNHISTORY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CMPSTNHISTORY table

CNTRLRFQHDR_D-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CNTRLRFQHDR_D table

COLL_MD_DRAFT-LASTCHANGEDATETIME table field - Last changed at

Description: Last changed at
Field Name: LASTCHANGEDATETIME
Data Element: UDM_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP COLL_MD_DRAFT table

CORDERDETAILS-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CORDERDETAILS table

CPCSRRCVDDATA-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCSRRCVDDATA table

CPCUSEHISTORY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPCUSEHISTORY table

CPDGCLFNCBRDT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPDGCLFNCBRDT table

CPECTXHISTORY-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPECTXHISTORY table

CPERMITDESCTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPERMITDESCTP table

CPLBILLINGDOC-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPLBILLINGDOC table

CPPMLNKDDOCTP-LASTCHANGEDATETIME table field - Timestamp of Last Change

Description: Timestamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: PPMGAG_E_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPPMLNKDDOCTP table

CPRODSPLYITEM-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CPRODSPLYITEM table

CRMS4D_SOM_AD-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRMS4D_SOM_AD table

CRMS4D_SOM_CO-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRMS4D_SOM_CO table

CRMS4D_SOM_PA-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CRMS4D_SOM_PA table

CSDDMRWFINBOX-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSDDMRWFINBOX table

CSDRAFT_ADMIN-LASTCHANGEDATETIME table field - Draft Last Changed On

Description: Draft Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: SDRAFT_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSDRAFT_ADMIN table

CSOWOCWLF2305-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: LAST_CHANGED_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CSOWOCWLF2305 table

CTEAMHEADERTP-LASTCHANGEDATETIME table field - UTC time stamp in long form (YYYYMMDDhhmmss,mmmuuun)

Description: UTC time stamp in long form (YYYYMMDDhhmmss,mmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CTEAMHEADERTP table

CUPDGCLFNIATA-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNIATA table

CUPDGCLFNIMDG-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNIMDG table

CUPDGCLFNSANS-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNSANS table

CUPDGCLFNUNDT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CUPDGCLFNUNDT table

CWRKCTROPRLTN-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CWRKCTROPRLTN table

CWRKCTROPSQNC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP CWRKCTROPSQNC table

DMND_TS_ADMIN-LASTCHANGEDATETIME table field - Timestamp of Last Object Change

Description: Timestamp of Last Object Change
Field Name: LASTCHANGEDATETIME
Data Element: TV_CHANGED_ON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP DMND_TS_ADMIN table

EAM_MJP_BUILD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EAM_MJP_BUILD table

EAM_PLNGBKT_D-LASTCHANGEDATETIME table field - Date and time the planning bucket was last changed

Description: Date and time the planning bucket was last changed
Field Name: LASTCHANGEDATETIME
Data Element: EAM_LASTCHANGEDAT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EAM_PLNGBKT_D table

EHSCMPLREQPER-LASTCHANGEDATETIME table field - Object Changed On/At

Description: Object Changed On/At
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP EHSCMPLREQPER table

ESH_L_CHGRCDH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_L_CHGRCDH table

ESH_L_JITDCNF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_L_JITDCNF table

ESH_L_MMSPAWD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_L_MMSPAWD table

ESH_U_CHGRCDH-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_U_CHGRCDH table

ESH_U_JITDCNF-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_U_JITDCNF table

ESH_U_MMSPAWD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDON
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ESH_U_MMSPAWD table

FAC_DZSALEITM-LASTCHANGEDATETIME table field - Time Stamp of Last Change

Description: Time Stamp of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: FIS_CHNG_TSTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAC_DZSALEITM table

FAP_PAYPLAN_D-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FAP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAP_PAYPLAN_D table

FAP_S_PAYPLAN-LASTCHANGEDATETIME table field - Last Changed Date Time

Description: Last Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FAP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAP_S_PAYPLAN table

FAR_PSTRL_D_R-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FAR_PSTRL_D_R table

FCLMGLACCOUNT-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FCLMGLACCOUNT table

FINRE_RULESET-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FINRE_RULESET table

FINS_GRIRPROC-LASTCHANGEDATETIME table field - GR/IR Clearing Process Last Change Date Time

Description: GR/IR Clearing Process Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: FIS_GRIR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FINS_GRIRPROC table

FIN_RE_S_RULE-LASTCHANGEDATETIME table field - Date and Time of Last Change

Description: Date and Time of Last Change
Field Name: LASTCHANGEDATETIME
Data Element: VDM_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FIN_RE_S_RULE table

FMEF_KBLK_UPD-LASTCHANGEDATETIME table field - Change Date and Time

Description: Change Date and Time
Field Name: LASTCHANGEDATETIME
Data Element: FMRE_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FMEF_KBLK_UPD table

FRM_EKKO_WA_T-LASTCHANGEDATETIME table field - Change Time Stamp

Description: Change Time Stamp
Field Name: LASTCHANGEDATETIME
Data Element: CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP FRM_EKKO_WA_T table

IABOPVARIANTD-LASTCHANGEDATETIME table field - Last Change Date Time

Description: Last Change Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ATP_BOP_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IABOPVARIANTD table

IACMSECIDRPTY-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: /PLMB/AUTH_TIMESTAMP
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IACMSECIDRPTY table

IACTTASKAPI01-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /SRMSMC/LAST_CHANGED_ON_TS
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IACTTASKAPI01 table

IALTVCHARCASS-LASTCHANGEDATETIME table field - Time Stamp of Last Change in Alternative-Based Confirmation

Description: Time Stamp of Last Change in Alternative-Based Confirmation
Field Name: LASTCHANGEDATETIME
Data Element: ATP_ABC_LASTCHANGE_TIMESTAMP
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IALTVCHARCASS table

IARNDMNDGRPRL-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IARNDMNDGRPRL table

IARNDMNDSRTRL-LASTCHANGEDATETIME table field - ARun Rule Changed Date Time

Description: ARun Rule Changed Date Time
Field Name: LASTCHANGEDATETIME
Data Element: ARUN_RULE_CHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IARNDMNDSRTRL table

IASMUSERTOMOD-LASTCHANGEDATETIME table field - Date and Time on Which the Object Was Last Changed

Description: Date and Time on Which the Object Was Last Changed
Field Name: LASTCHANGEDATETIME
Data Element: RFM_ASM_LAST_CHANGED_AT
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IASMUSERTOMOD table

IBSPALLITEMTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBSPALLITEMTP table

IBUSINESSUSER-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: CHAR
length (Dec): 14(0)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP IBUSINESSUSER table

ICCCUSTOMERHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCCUSTOMERHD table

ICCMATERIALHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCMATERIALHD table

ICCRIHIERDIR2-LASTCHANGEDATETIME table field - Last Updated at (Timestamp)

Description: Last Updated at (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: FINCS_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCRIHIERDIR2 table

ICCSEGHIERDIR-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCSEGHIERDIR table

ICCSUPPLIERHD-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICCSUPPLIERHD table

ICHFIEXCLFNKD-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHFIEXCLFNKD table

ICHGRECORDTP2-LASTCHANGEDATETIME table field -

Description:
Field Name: LASTCHANGEDATETIME
Data Element:
Data Type: DEC
length (Dec): 22(7)
Check table:
Conversion Routine:
Domain Name:
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHGRECORDTP2 table

ICHPLASSIGNTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLASSIGNTP table

ICHPLCOUNTRTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLCOUNTRTP table

ICHPLPARAMATP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAMATP table

ICHPLPARAMDTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAMDTP table

ICHPLPARAMNTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAMNTP table

ICHPLPARAMSTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAMSTP table

ICHPLPARAMTTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAMTTP table

ICHPLPARAMUTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICHPLPARAMUTP table

ICMMDTYORDBKT-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMMDTYORDBKT table

ICMMDTYORDDOC-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMMDTYORDDOC table

ICMMDTYORDLEG-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMMDTYORDLEG table

ICMMDTYORDREQ-LASTCHANGEDATETIME table field - Timestamp of last change

Description: Timestamp of last change
Field Name: LASTCHANGEDATETIME
Data Element: CMMFDOR_LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMMDTYORDREQ table

ICMPLNCPRPSTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMPLNCPRPSTP table

ICMPLSCENNAME-LASTCHANGEDATETIME table field - Date/Time of Item Change

Description: Date/Time of Item Change
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/DATETIME_CH
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: /BOBF/TIMESTAMP
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICMPLSCENNAME table

ICNTXIBNDGHDR-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXIBNDGHDR table

ICNTXIBNDGITM-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXIBNDGITM table

ICNTXITRANSFI-LASTCHANGEDATETIME table field - China Tax Invoice Administration Data Changing Time

Description: China Tax Invoice Administration Data Changing Time
Field Name: LASTCHANGEDATETIME
Data Element: FICNTAX_CHANGE_TIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICNTXITRANSFI table

ICPACASSIGNTP-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPACASSIGNTP table

ICPCRASSGMTTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICPCRASSGMTTP table

ICRRARMENVPTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMENVPTP table

ICRRARMPPEPTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRARMPPEPTP table

ICRRDGNOTESTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGNOTESTP table

ICRRDGPHZDLBL-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRDGPHZDLBL table

ICRREFINSPBSC-LASTCHANGEDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)

Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
Field Name: LASTCHANGEDATETIME
Data Element: TZNTSTMPS
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRREFINSPBSC table

ICRRFAMASMTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMASMTTP table

ICRRFAMEFFECT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMEFFECT table

ICRRFAMINHLTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMINHLTP table

ICRRFAMPROTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMPROTTP table

ICRRFAMSKINTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFAMSKINTP table

ICRRFFMASMTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMASMTTP table

ICRRFFMHZRDTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMHZRDTP table

ICRRFFMMTHDTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRFFMMTHDTP table

ICRRHZIASSMTD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRHZIASSMTD table

ICRROELASSMTD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRROELASSMTD table

ICRROELCOMPTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRROELCOMPTP table

ICRROSMASSGMT-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: EHFND_BO_LCHG_DATE_TIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRROSMASSGMT table

ICRRPPMASMTTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMASMTTP table

ICRRPPMFLTRTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMFLTRTP table

ICRRPPMHANDTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMHANDTP table

ICRRPPMRSPRTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMRSPRTP table

ICRRPPMSKINTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRPPMSKINTP table

ICRRSARAASMTD-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSARAASMTD table

ICRRSARACATTP-LASTCHANGEDATETIME table field - Last Changed On

Description: Last Changed On
Field Name: LASTCHANGEDATETIME
Data Element: /BOBF/LASTCHANGEDATETIME
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSARACATTP table

ICRRSDSCTRYTP-LASTCHANGEDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)

Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
Field Name: LASTCHANGEDATETIME
Data Element: TIMESTAMPL
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRRSDSCTRYTP table

ICRSCTLGVRSNT-LASTCHANGEDATETIME table field - Changed At

Description: Changed At
Field Name: LASTCHANGEDATETIME
Data Element: CRMS4_SOM_CHANGED_AT
Data Type: DEC
length (Dec): 21(7)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPL
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICRSCTLGVRSNT table

ICSCUSTGRPHDE-LASTCHANGEDATETIME table field - Last Updated At (Timestamp)

Description: Last Updated At (Timestamp)
Field Name: LASTCHANGEDATETIME
Data Element: HRYUPDTIME
Data Type: DEC
length (Dec): 15(0)
Check table:
Conversion Routine:
Domain Name: TZNTSTMPS
MemoryID:
AppClass:
SHLP:
SHLP Field:
ConvExit:

See details of SAP ICSCUS