Details |
CINSPRSLTHSTRY-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
CINSPRSLTHSTRY-INSPECTIONLOT table field - Inspection Lot Number
▼
Description: Inspection Lot Number Field Name: INSPECTIONLOT Data Element: QPLOS Data Type: NUMC length (Dec): 12(0) Check table: QALS Conversion Routine: ALPHA Domain Name: QPLOS MemoryID: QLS AppClass: FBZ SHLP: QALS SHLP Field: PRUEFLOS ConvExit: ALPHA See all SAP tables containing field INSPECTIONLOT
|
CINSPRSLTHSTRY-INSPPLANOPERATIONINTERNALID table field - Current Node Number from Order Counter
▼
Description: Current Node Number from Order Counter Field Name: INSPPLANOPERATIONINTERNALID Data Element: QLFNKN Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: KNTNR MemoryID: QOPER AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPPLANOPERATIONINTERNALID
|
CINSPRSLTHSTRY-INSPECTIONCHARACTERISTIC table field - Inspection Characteristic Number
▼
Description: Inspection Characteristic Number Field Name: INSPECTIONCHARACTERISTIC Data Element: QMERKNRP Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QMERKNRP MemoryID: QCHAR AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONCHARACTERISTIC
|
CINSPRSLTHSTRY-INSPECTIONOPERATION table field - Operation/Activity Number
▼
Description: Operation/Activity Number Field Name: INSPECTIONOPERATION Data Element: VORNR Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: NUMCV Domain Name: VORNR MemoryID: VGN AppClass: CP SHLP: SHLP Field: ConvExit: NUMCV See all SAP tables containing field INSPECTIONOPERATION
|
CINSPRSLTHSTRY-INSPECTIONSPECIFICATIONPLANT table field - Plant for Master Inspection Characteristic
▼
Description: Plant for Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONPLANT Data Element: VDM_QPMK_WERKS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QZAEHLER MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONPLANT
|
CINSPRSLTHSTRY-INSPECTIONSPECIFICATION table field - Master Inspection Characteristic
▼
Description: Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATION Data Element: QMERKNR Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: ALPHA Domain Name: QMERKNR MemoryID: PMK AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONSPECIFICATION
|
CINSPRSLTHSTRY-INSPECTIONSPECIFICATIONVERSION table field - Version Number of Master Inspection Characteristic
▼
Description: Version Number of Master Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONVERSION Data Element: QVERSNRMK Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: ALPHA Domain Name: QVERSNR MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPECTIONSPECIFICATIONVERSION
|
CINSPRSLTHSTRY-INSPECTIONLOTORIGIN table field - Inspection Lot Origin
▼
Description: Inspection Lot Origin Field Name: INSPECTIONLOTORIGIN Data Element: VDM_QHERK Data Type: CHAR length (Dec): 2(0) Check table: TQ31 Conversion Routine: Domain Name: QHERK MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTORIGIN
|
CINSPRSLTHSTRY-INSPECTIONLOTTYPE table field - Inspection Type
▼
Description: Inspection Type Field Name: INSPECTIONLOTTYPE Data Element: QPART Data Type: CHAR length (Dec): 8(0) Check table: TQ30 Conversion Routine: Domain Name: QPART MemoryID: QLA AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONLOTTYPE
|
CINSPRSLTHSTRY-INSPLOTSELECTIONSUPPLIER table field - Vendor's account number
▼
Description: Vendor's account number Field Name: INSPLOTSELECTIONSUPPLIER Data Element: ELIFN Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: KRED_C SHLP Field: LIFNR ConvExit: ALPHA See all SAP tables containing field INSPLOTSELECTIONSUPPLIER
|
CINSPRSLTHSTRY-INSPLOTSELECTIONCUSTOMER table field - Account number of customer
▼
Description: Account number of customer Field Name: INSPLOTSELECTIONCUSTOMER Data Element: EKUNN Data Type: CHAR length (Dec): 10(0) Check table: KNA1 Conversion Routine: ALPHA Domain Name: KUNNR MemoryID: KUN AppClass: V SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPLOTSELECTIONCUSTOMER
|
CINSPRSLTHSTRY-INSPLOTSELECTIONMANUFACTURER table field - Number of Manufacturer
▼
Description: Number of Manufacturer Field Name: INSPLOTSELECTIONMANUFACTURER Data Element: QLIFNR Data Type: CHAR length (Dec): 10(0) Check table: LFA1 Conversion Routine: ALPHA Domain Name: LIFNR MemoryID: LIF AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field INSPLOTSELECTIONMANUFACTURER
|
CINSPRSLTHSTRY-BATCH table field - Batch Number
▼
Description: Batch Number Field Name: BATCH Data Element: CHARG_D Data Type: CHAR length (Dec): 10(0) Check table: MCH1 Conversion Routine: Domain Name: CHARG MemoryID: CHA AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field BATCH
|
CINSPRSLTHSTRY-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: T001W Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
|
CINSPRSLTHSTRY-INSPLOTSELECTIONMATERIAL table field - Material Number
▼
Description: Material Number Field Name: INSPLOTSELECTIONMATERIAL Data Element: MATNR Data Type: CHAR length (Dec): 40(0) Check table: MARA Conversion Routine: MATN1 Domain Name: MATNR MemoryID: MAT AppClass: MG SHLP: S_MAT1 SHLP Field: MATNR ConvExit: MATN1 See all SAP tables containing field INSPLOTSELECTIONMATERIAL
|
CINSPRSLTHSTRY-CREATIONDATE table field - System Date on Which Data Record Was Created
▼
Description: System Date on Which Data Record Was Created Field Name: CREATIONDATE Data Element: QDATUMERST Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field CREATIONDATE
|
CINSPRSLTHSTRY-BILLOFOPERATIONSTYPE table field - Bill of Operations Type
▼
Description: Bill of Operations Type Field Name: BILLOFOPERATIONSTYPE Data Element: VDM_PLNTY Data Type: CHAR length (Dec): 1(0) Check table: TCA01 Conversion Routine: Domain Name: PLNTY MemoryID: PTY AppClass: CP SHLP: H_TCA01 SHLP Field: PLNTY ConvExit: See all SAP tables containing field BILLOFOPERATIONSTYPE
|
CINSPRSLTHSTRY-BILLOFOPERATIONSGROUP table field - Bill of Operations Group
▼
Description: Bill of Operations Group Field Name: BILLOFOPERATIONSGROUP Data Element: VDM_PLNNR Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: ALPHA Domain Name: PLNNR MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field BILLOFOPERATIONSGROUP
|
CINSPRSLTHSTRY-BILLOFOPERATIONSVARIANT table field - Bill of Operations Group Counter
▼
Description: Bill of Operations Group Counter Field Name: BILLOFOPERATIONSVARIANT Data Element: VDM_PLNAL Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: ALPHA Domain Name: ALTNR MemoryID: AppClass: CS SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field BILLOFOPERATIONSVARIANT
|
CINSPRSLTHSTRY-MATLQUALITYAUTHORIZATIONGROUP table field - Material Authorization Group for Activities in QM
▼
Description: Material Authorization Group for Activities in QM Field Name: MATLQUALITYAUTHORIZATIONGROUP Data Element: VDM_QMATAUTH Data Type: CHAR length (Dec): 6(0) Check table: TQ01B Conversion Routine: Domain Name: QMATAUTH MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLQUALITYAUTHORIZATIONGROUP
|
CINSPRSLTHSTRY-BOOCHARACTERISTICVERSION table field - Internal counter
▼
Description: Internal counter Field Name: BOOCHARACTERISTICVERSION Data Element: CIM_COUNT Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: CIM_COUNT MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOCHARACTERISTICVERSION
|
CINSPRSLTHSTRY-WORKCENTERINTERNALID table field - Object ID of the resource
▼
Description: Object ID of the resource Field Name: WORKCENTERINTERNALID Data Element: CR_OBJID Data Type: NUMC length (Dec): 8(0) Check table: CRID Conversion Routine: Domain Name: CR_OBJID MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTERINTERNALID
|
CINSPRSLTHSTRY-BOOOPERATIONINTERNALID table field - Number of the Task List Node
▼
Description: Number of the Task List Node Field Name: BOOOPERATIONINTERNALID Data Element: PLNKN Data Type: NUMC length (Dec): 8(0) Check table: Conversion Routine: Domain Name: KNTNR MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field BOOOPERATIONINTERNALID
|
CINSPRSLTHSTRY-INSPECTIONRESULTSTATUS table field - Results Record Status
▼
Description: Results Record Status Field Name: INSPECTIONRESULTSTATUS Data Element: QBEASTATUS Data Type: CHAR length (Dec): 1(0) Check table: TQ76 Conversion Routine: Domain Name: QSTATUS MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTSTATUS
|
CINSPRSLTHSTRY-INSPECTIONVALUATIONRESULT table field - Inspection Result Valuation
▼
Description: Inspection Result Valuation Field Name: INSPECTIONVALUATIONRESULT Data Element: QMBEWERTG Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QEEBEWERTG MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONVALUATIONRESULT
|
CINSPRSLTHSTRY-INSPECTIONSPECIFICATIONUNIT table field - Unit of Measurement in Which Quantitative Data Is Stored
▼
Description: Unit of Measurement in Which Quantitative Data Is Stored Field Name: INSPECTIONSPECIFICATIONUNIT Data Element: QMASSEH Data Type: UNIT length (Dec): 3(0) Check table: T006 Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field INSPECTIONSPECIFICATIONUNIT
|
CINSPRSLTHSTRY-INSPSPECDECIMALPLACES table field - Number of Places to the Right of a Decimal Point (Accuracy)
▼
Description: Number of Places to the Right of a Decimal Point (Accuracy) Field Name: INSPSPECDECIMALPLACES Data Element: QSTELLEN Data Type: INT1 length (Dec): 3(0) Check table: Conversion Routine: Domain Name: QSTELLEN MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECDECIMALPLACES
|
CINSPRSLTHSTRY-INSPCHARCISNOTPLANNED table field - Unplanned Characteristic
▼
Description: Unplanned Characteristic Field Name: INSPCHARCISNOTPLANNED Data Element: VDM_QNIPLANMK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: VDM_QKZ_BOOL MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARCISNOTPLANNED
|
CINSPRSLTHSTRY-INSPSPECTARGETVALUE table field - Target Value for a Quantitative Characteristic
▼
Description: Target Value for a Quantitative Characteristic Field Name: INSPSPECTARGETVALUE Data Element: QSOLLWERTE Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECTARGETVALUE
|
CINSPRSLTHSTRY-INSPSPECHASUPPERLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASUPPERLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASUPPERLIMIT
|
CINSPRSLTHSTRY-INSPSPECUPPERLIMIT table field - Upper Specification Limit
▼
Description: Upper Specification Limit Field Name: INSPSPECUPPERLIMIT Data Element: QTOLOB Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECUPPERLIMIT
|
CINSPRSLTHSTRY-INSPSPECHASLOWERLIMIT table field - Value Not Initial if Set
▼
Description: Value Not Initial if Set Field Name: INSPSPECHASLOWERLIMIT Data Element: QNINITIAL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECHASLOWERLIMIT
|
CINSPRSLTHSTRY-INSPSPECLOWERLIMIT table field - Lower Specification Limit
▼
Description: Lower Specification Limit Field Name: INSPSPECLOWERLIMIT Data Element: QTOLUN Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSOLLWERTE MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECLOWERLIMIT
|
CINSPRSLTHSTRY-INSPSPECRECORDINGTYPE table field - Recording Type
▼
Description: Recording Type Field Name: INSPSPECRECORDINGTYPE Data Element: QESTUKZ Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QESTUKZ MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECRECORDINGTYPE
|
CINSPRSLTHSTRY-INSPECTIONRESULTMEANVALUE table field - Arithmetic Mean of Valid Measured Values
▼
Description: Arithmetic Mean of Valid Measured Values Field Name: INSPECTIONRESULTMEANVALUE Data Element: QMITTELWRT Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSTATWERT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTMEANVALUE
|
CINSPRSLTHSTRY-INSPRSLTWEIGHTEDMEANVALUE table field -
▼
Description: Field Name: INSPRSLTWEIGHTEDMEANVALUE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTWEIGHTEDMEANVALUE
|
CINSPRSLTHSTRY-INSPECTIONRESULTMAXIMUMVALUE table field - Maximum Value of Valid Measured Values
▼
Description: Maximum Value of Valid Measured Values Field Name: INSPECTIONRESULTMAXIMUMVALUE Data Element: QMAXWERT Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSTATWERT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTMAXIMUMVALUE
|
CINSPRSLTHSTRY-INSPECTIONRESULTMINIMUMVALUE table field - Minimum Value of Valid Measured Values
▼
Description: Minimum Value of Valid Measured Values Field Name: INSPECTIONRESULTMINIMUMVALUE Data Element: QMINWERT Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSTATWERT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTMINIMUMVALUE
|
CINSPRSLTHSTRY-INSPRESULTVALIDVALUESNUMBER table field - Number of Inspected Sample Units
▼
Description: Number of Inspected Sample Units Field Name: INSPRESULTVALIDVALUESNUMBER Data Element: QANZWERTG4 Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QANZAHL4 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTVALIDVALUESNUMBER
|
CINSPRSLTHSTRY-INSPRSLTNONCONFORMINGVALSNMBR table field - Number of Nonconforming Sample Units
▼
Description: Number of Nonconforming Sample Units Field Name: INSPRSLTNONCONFORMINGVALSNMBR Data Element: QANZFEHEH4 Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QANZAHL4 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTNONCONFORMINGVALSNMBR
|
CINSPRSLTHSTRY-INSPRSLTABOVETOLERANCEVALSNMBR table field - Number of Measured Values Above Tolerance Range
▼
Description: Number of Measured Values Above Tolerance Range Field Name: INSPRSLTABOVETOLERANCEVALSNMBR Data Element: QANZWERTO4 Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QANZAHL4 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTABOVETOLERANCEVALSNMBR
|
CINSPRSLTHSTRY-INSPRSLTBELOWTOLERANCEVALSNMBR table field - Number of Measured Values Below Tolerance Range
▼
Description: Number of Measured Values Below Tolerance Range Field Name: INSPRSLTBELOWTOLERANCEVALSNMBR Data Element: QANZWERTU4 Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QANZAHL4 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTBELOWTOLERANCEVALSNMBR
|
CINSPRSLTHSTRY-INSPECTIONRESULTTEXT table field - Inspection Description for Summarized Result
▼
Description: Inspection Description for Summarized Result Field Name: INSPECTIONRESULTTEXT Data Element: VDM_QINSPECTIONRESULTDESC Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: QKURZTEXT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTTEXT
|
CINSPRSLTHSTRY-INSPECTOR table field - Name of Inspector
▼
Description: Name of Inspector Field Name: INSPECTOR Data Element: QPRUEFER Data Type: CHAR length (Dec): 12(0) Check table: Conversion Routine: Domain Name: QPRUEFER MemoryID: QPR AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTOR
|
CINSPRSLTHSTRY-INSPECTIONRESULTATTRIBUTE table field - Attribute of the Results Record (Valid, Invalid,...)
▼
Description: Attribute of the Results Record (Valid, Invalid,...) Field Name: INSPECTIONRESULTATTRIBUTE Data Element: QATTRIBUT Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QATTRIBUT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTATTRIBUTE
|
CINSPRSLTHSTRY-INSPRESULTVARIANCE table field - Dispersion (Variance) of Valid Measured Values
▼
Description: Dispersion (Variance) of Valid Measured Values Field Name: INSPRESULTVARIANCE Data Element: QVARIANZ Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSTATWERT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTVARIANCE
|
CINSPRSLTHSTRY-INSPRSLTABOVETOLERANCEFRACTION table field - Estimated Fraction Above Tolerance Range
▼
Description: Estimated Fraction Above Tolerance Range Field Name: INSPRSLTABOVETOLERANCEFRACTION Data Element: QANTEILO Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSTATWERT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTABOVETOLERANCEFRACTION
|
CINSPRSLTHSTRY-INSPRSLTBELOWTOLERANCEFRACTION table field - Estimated Fraction Below Tolerance Range
▼
Description: Estimated Fraction Below Tolerance Range Field Name: INSPRSLTBELOWTOLERANCEFRACTION Data Element: QANTEILU Data Type: FLTP length (Dec): 16(16) Check table: Conversion Routine: Domain Name: QSTATWERT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTBELOWTOLERANCEFRACTION
|
CINSPRSLTHSTRY-INSPECTIONRESULTORIGINALVALUE table field - Original Value Before Input Processing
▼
Description: Original Value Before Input Processing Field Name: INSPECTIONRESULTORIGINALVALUE Data Element: QORIGINAL_INPUT Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: CHAR25 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONRESULTORIGINALVALUE
|
CINSPRSLTHSTRY-INSPECTIONSPECIFICATIONTEXT table field - Short Text for Inspection Characteristic
▼
Description: Short Text for Inspection Characteristic Field Name: INSPECTIONSPECIFICATIONTEXT Data Element: VDM_QMKKURZTXT Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: Domain Name: QKURZTEXT MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSPECIFICATIONTEXT
|
CINSPRSLTHSTRY-INSPSPECSAMPLEQUANTITYFACTOR table field - Sample Quantity Factor for Sample(Mult. Sample Unit of Msr.)
▼
Description: Sample Quantity Factor for Sample(Mult. Sample Unit of Msr.) Field Name: INSPSPECSAMPLEQUANTITYFACTOR Data Element: QPROBEFAK Data Type: DEC length (Dec): 5(2) Check table: Conversion Routine: Domain Name: QPROBEFAK MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECSAMPLEQUANTITYFACTOR
|
CINSPRSLTHSTRY-INSPCHARACTERISTICSAMPLEUNIT table field - Sample Unit of Measure
▼
Description: Sample Unit of Measure Field Name: INSPCHARACTERISTICSAMPLEUNIT Data Element: QPROBME Data Type: UNIT length (Dec): 3(0) Check table: T006 Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field INSPCHARACTERISTICSAMPLEUNIT
|
CINSPRSLTHSTRY-INSPCHARACTERISTICSAMPLESIZE table field - Sample Size that Has to Be Inspected for a Characteristic
▼
Description: Sample Size that Has to Be Inspected for a Characteristic Field Name: INSPCHARACTERISTICSAMPLESIZE Data Element: QGESUMF Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QANZAHL4 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPCHARACTERISTICSAMPLESIZE
|
CINSPRSLTHSTRY-INSPECTIONSAMPLESIZE table field - Sample Size that Has to Be Inspected for a Characteristic
▼
Description: Sample Size that Has to Be Inspected for a Characteristic Field Name: INSPECTIONSAMPLESIZE Data Element: QGESUMF Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: QANZAHL4 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONSAMPLESIZE
|
CINSPRSLTHSTRY-CHARACTERISTICATTRIBUTECODEGRP table field - Code Group
▼
Description: Code Group Field Name: CHARACTERISTICATTRIBUTECODEGRP Data Element: QCODEGRP Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: QCODEGRP MemoryID: CGP AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHARACTERISTICATTRIBUTECODEGRP
|
CINSPRSLTHSTRY-CHARACTERISTICATTRIBUTECODE table field - Code
▼
Description: Code Field Name: CHARACTERISTICATTRIBUTECODE Data Element: QCODE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: QCODE MemoryID: QCODE AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CHARACTERISTICATTRIBUTECODE
|
CINSPRSLTHSTRY-INSPECTIONPARTIALSAMPLESIZE table field - Number of Partial Samples for Characteristic
▼
Description: Number of Partial Samples for Characteristic Field Name: INSPECTIONPARTIALSAMPLESIZE Data Element: QANZSTIPRO Data Type: INT2 length (Dec): 5(0) Check table: Conversion Routine: Domain Name: QANZAHL2 MemoryID: AppClass: QSS SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPECTIONPARTIALSAMPLESIZE
|
CINSPRSLTHSTRY-WORKCENTER table field - Work Center
▼
Description: Work Center Field Name: WORKCENTER Data Element: PPH_ARBPL Data Type: CHAR length (Dec): 8(0) Check table: Conversion Routine: Domain Name: ARBPL MemoryID: AGR AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field WORKCENTER
|
CINSPRSLTHSTRY-INSPRESULTFRMTDMEANVALUE table field - Arithmetic Mean of Valid Measured Values (Formatted)
▼
Description: Arithmetic Mean of Valid Measured Values (Formatted) Field Name: INSPRESULTFRMTDMEANVALUE Data Element: QMITTELWRT_F Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: QSTATWERT_F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTFRMTDMEANVALUE
|
CINSPRSLTHSTRY-INSPRESULTFRMTDMINIMUMVALUE table field - Minimum Value of Valid Measured Values (Formatted)
▼
Description: Minimum Value of Valid Measured Values (Formatted) Field Name: INSPRESULTFRMTDMINIMUMVALUE Data Element: QMINWERT_F Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: QSTATWERT_F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTFRMTDMINIMUMVALUE
|
CINSPRSLTHSTRY-INSPRESULTFRMTDMAXIMUMVALUE table field - Maximum Value of Valid Measured Values - formatted
▼
Description: Maximum Value of Valid Measured Values - formatted Field Name: INSPRESULTFRMTDMAXIMUMVALUE Data Element: QMAXWERT_F Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: QSTATWERT_F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTFRMTDMAXIMUMVALUE
|
CINSPRSLTHSTRY-INSPRESULTFRMTDVARIANCE table field - Dispersion (Variance) of Valid Measured Values (Formatted)
▼
Description: Dispersion (Variance) of Valid Measured Values (Formatted) Field Name: INSPRESULTFRMTDVARIANCE Data Element: QVARIANZ_F Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: QSTATWERT_F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRESULTFRMTDVARIANCE
|
CINSPRSLTHSTRY-INSPRSLTFRMTDABVTOLFRACTION table field - Dispersion (Variance) of Valid Measured Values (Formatted)
▼
Description: Dispersion (Variance) of Valid Measured Values (Formatted) Field Name: INSPRSLTFRMTDABVTOLFRACTION Data Element: QVARIANZ_F Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: QSTATWERT_F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTFRMTDABVTOLFRACTION
|
CINSPRSLTHSTRY-INSPRSLTFRMTDBELOWTOLFRACTION table field - Dispersion (Variance) of Valid Measured Values (Formatted)
▼
Description: Dispersion (Variance) of Valid Measured Values (Formatted) Field Name: INSPRSLTFRMTDBELOWTOLFRACTION Data Element: QVARIANZ_F Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: QSTATWERT_F MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPRSLTFRMTDBELOWTOLFRACTION
|
CINSPRSLTHSTRY-INSPSPECCHARACTERISTICTYPE table field - Characteristic Type
▼
Description: Characteristic Type Field Name: INSPSPECCHARACTERISTICTYPE Data Element: VDM_QCHAR_TYPE_BASIC Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: QCHAR_TYPE_BASIC MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field INSPSPECCHARACTERISTICTYPE
|
CINSPRSLTHSTRY-ISBUSINESSPURPOSECOMPLETED table field - Business Purpose Completed Flag
▼
Description: Business Purpose Completed Flag Field Name: ISBUSINESSPURPOSECOMPLETED Data Element: CVP_XBLCK Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CVP_XBLCK MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISBUSINESSPURPOSECOMPLETED
|