SAP PMATKPIMATAVG table - Generated Table for View details in SAP
Show table
SAP PMATKPIMATAVG table summary Object Name: PMATKPIMATAVG Dictionary Type: Table viewDescription: Generated Table for View
Field list for PMATKPIMATAVG table on an S/4 SAP system
Details
PMATKPIMATAVG-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
PMATKPIMATAVG-MATERIAL table field - Material in Respect of Which Stock is Managed
▼
Description: Material in Respect of Which Stock is Managed Field Name: MATERIAL Data Element: MATBF Data Type: CHAR length (Dec): 40(0) Check table: Conversion Routine: MATN1 Domain Name: MATNR MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: MATN1 See all SAP tables containing field MATERIAL
PMATKPIMATAVG-PLANT table field - Plant
▼
Description: Plant Field Name: PLANT Data Element: WERKS_D Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: H_T001W_C SHLP Field: WERKS ConvExit: See all SAP tables containing field PLANT
PMATKPIMATAVG-MATERIALBASEUNIT table field - Base Unit of Measure
▼
Description: Base Unit of Measure Field Name: MATERIALBASEUNIT Data Element: MEINS Data Type: UNIT length (Dec): 3(0) Check table: Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT See all SAP tables containing field MATERIALBASEUNIT
PMATKPIMATAVG-MATLWRHSSTKQTYONENDDATE table field -
▼
Description: Field Name: MATLWRHSSTKQTYONENDDATE Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MATLWRHSSTKQTYONENDDATE
PMATKPIMATAVG-STOCKVALUEINCCCRCYEND table field -
▼
Description: Field Name: STOCKVALUEINCCCRCYEND Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOCKVALUEINCCCRCYEND
PMATKPIMATAVG-AVGMATLSTKQTYINMATLBASEUNIT table field -
▼
Description: Field Name: AVGMATLSTKQTYINMATLBASEUNIT Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVGMATLSTKQTYINMATLBASEUNIT
PMATKPIMATAVG-AVGMATLSTKAMOUNTINCOMPANYCRCY table field -
▼
Description: Field Name: AVGMATLSTKAMOUNTINCOMPANYCRCY Data Element: Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field AVGMATLSTKAMOUNTINCOMPANYCRCY
PMATKPIMATAVG-CURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: CURRENCY Data Element: WAERS Data Type: CUKY length (Dec): 5(0) Check table: TCURC Conversion Routine: Domain Name: WAERS MemoryID: FWS AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
Search SAP tables
View list of all SAP tables(S4H/ECC) Select data from SAP table