Details |
MMPUR_STR_HISTORYDETAILS-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
MMPUR_STR_HISTORYDETAILS-EBELN table field - Purchasing Document Number
▼
Description: Purchasing Document Number Field Name: EBELN Data Element: EBELN Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: EBELN MemoryID: BES AppClass: ME SHLP: MEKK_C SHLP Field: EBELN ConvExit: ALPHA See all SAP tables containing field EBELN
|
MMPUR_STR_HISTORYDETAILS-EBELP table field - Item Number of Purchasing Document
▼
Description: Item Number of Purchasing Document Field Name: EBELP Data Element: EBELP Data Type: NUMC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: EBELP MemoryID: BSP AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field EBELP
|
MMPUR_STR_HISTORYDETAILS-BELNR table field - Number of Material Document
▼
Description: Number of Material Document Field Name: BELNR Data Element: MBLNR Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: ALPHA Domain Name: BELNR MemoryID: MBN AppClass: FB SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field BELNR
|
MMPUR_STR_HISTORYDETAILS-BUZEI table field - Item in Material Document
▼
Description: Item in Material Document Field Name: BUZEI Data Element: MBLPO Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: MBLPO MemoryID: POS AppClass: MB SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUZEI
|
MMPUR_STR_HISTORYDETAILS-VGABE table field - Transaction/event type, purchase order history
▼
Description: Transaction/event type, purchase order history Field Name: VGABE Data Element: VGABE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: VGABE MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field VGABE
|
MMPUR_STR_HISTORYDETAILS-GJAHR table field - Material Document Year
▼
Description: Material Document Year Field Name: GJAHR Data Element: MJAHR Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: GJAHR Domain Name: GJAHR MemoryID: MJA AppClass: SAP SHLP: SHLP Field: ConvExit: GJAHR See all SAP tables containing field GJAHR
|
MMPUR_STR_HISTORYDETAILS-ETENR table field - Delivery Schedule Line Counter
▼
Description: Delivery Schedule Line Counter Field Name: ETENR Data Element: EETEN Data Type: NUMC length (Dec): 4(0) Check table: Conversion Routine: Domain Name: EETEN MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field ETENR
|
MMPUR_STR_HISTORYDETAILS-ISFINALSCHEDULELINE table field - Final Schedule Line
▼
Description: Final Schedule Line Field Name: ISFINALSCHEDULELINE Data Element: FINAL_SCHEDULE_LINE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: XFELD MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field ISFINALSCHEDULELINE
|
MMPUR_STR_HISTORYDETAILS-HASREVERSAL table field - 1 Byte Unsigned Integer
▼
Description: 1 Byte Unsigned Integer Field Name: HASREVERSAL Data Element: INT1 Data Type: INT1 length (Dec): 3(0) Check table: Conversion Routine: Domain Name: INT1 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field HASREVERSAL
|
MMPUR_STR_HISTORYDETAILS-BSART table field - Purchasing Document Type
▼
Description: Purchasing Document Type Field Name: BSART Data Element: ESART Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BSART MemoryID: BSA AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field BSART
|
MMPUR_STR_HISTORYDETAILS-EKORG table field - Purchasing organization
▼
Description: Purchasing organization Field Name: EKORG Data Element: EKORG Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: EKORG MemoryID: EKO AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field EKORG
|
MMPUR_STR_HISTORYDETAILS-EKGRP table field - Purchasing Group
▼
Description: Purchasing Group Field Name: EKGRP Data Element: BKGRP Data Type: CHAR length (Dec): 3(0) Check table: Conversion Routine: Domain Name: EKGRP MemoryID: EKG AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field EKGRP
|
MMPUR_STR_HISTORYDETAILS-WERKS table field - Plant
▼
Description: Plant Field Name: WERKS Data Element: EWERK Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: WERKS MemoryID: WRK AppClass: MG SHLP: SHLP Field: ConvExit: See all SAP tables containing field WERKS
|
MMPUR_STR_HISTORYDETAILS-MATKL table field - Material Group
▼
Description: Material Group Field Name: MATKL Data Element: MATKL Data Type: CHAR length (Dec): 9(0) Check table: Conversion Routine: Domain Name: MATKL MemoryID: MKL AppClass: MG SHLP: S_WBWG SHLP Field: MATKL ConvExit: See all SAP tables containing field MATKL
|
MMPUR_STR_HISTORYDETAILS-PURCHASINGCATEGORY table field - Purchasing Category ID
▼
Description: Purchasing Category ID Field Name: PURCHASINGCATEGORY Data Element: /SRMSMC/PURCHASING_CATEGORY_ID Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: ALPHA Domain Name: /SRMSMC/OBJECT_ID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field PURCHASINGCATEGORY
|
MMPUR_STR_HISTORYDETAILS-BUDAT table field - Posting Date in the Document
▼
Description: Posting Date in the Document Field Name: BUDAT Data Element: BUDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field BUDAT
|
MMPUR_STR_HISTORYDETAILS-MENGE table field - Quantity
▼
Description: Quantity Field Name: MENGE Data Element: MENGE_D Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: MENG13 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MENGE
|
MMPUR_STR_HISTORYDETAILS-FIRSTGRPOSTINGDATE table field - Field of type DATS
▼
Description: Field of type DATS Field Name: FIRSTGRPOSTINGDATE Data Element: DATS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FIRSTGRPOSTINGDATE
|
MMPUR_STR_HISTORYDETAILS-FINALGRPOSTINGDATE table field - Field of type DATS
▼
Description: Field of type DATS Field Name: FINALGRPOSTINGDATE Data Element: DATS Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FINALGRPOSTINGDATE
|
MMPUR_STR_HISTORYDETAILS-TOTALDELIVEREDQUANTITY table field - Quantity in GR blocked stock in order price unit
▼
Description: Quantity in GR blocked stock in order price unit Field Name: TOTALDELIVEREDQUANTITY Data Element: BPWES Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: MENG13 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field TOTALDELIVEREDQUANTITY
|
MMPUR_STR_HISTORYDETAILS-LASTDELIVEREDQUANTITY table field - Quantity in GR blocked stock in order price unit
▼
Description: Quantity in GR blocked stock in order price unit Field Name: LASTDELIVEREDQUANTITY Data Element: BPWES Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: MENG13 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field LASTDELIVEREDQUANTITY
|
MMPUR_STR_HISTORYDETAILS-GRSATISFYINGSCHEDLINE table field - Quantity in GR blocked stock in order price unit
▼
Description: Quantity in GR blocked stock in order price unit Field Name: GRSATISFYINGSCHEDLINE Data Element: BPWES Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: MENG13 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field GRSATISFYINGSCHEDLINE
|
MMPUR_STR_HISTORYDETAILS-OUTSTANDINGQTYCURRGR table field - Quantity in GR blocked stock in order price unit
▼
Description: Quantity in GR blocked stock in order price unit Field Name: OUTSTANDINGQTYCURRGR Data Element: BPWES Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: MENG13 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field OUTSTANDINGQTYCURRGR
|
MMPUR_STR_HISTORYDETAILS-OUTSTANDINGQTYLASTGR table field - Quantity in GR blocked stock in order price unit
▼
Description: Quantity in GR blocked stock in order price unit Field Name: OUTSTANDINGQTYLASTGR Data Element: BPWES Data Type: QUAN length (Dec): 13(3) Check table: Conversion Routine: Domain Name: MENG13 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field OUTSTANDINGQTYLASTGR
|
MMPUR_STR_HISTORYDETAILS-TIMEVARIANCE table field - 4 Byte Signed Integer
▼
Description: 4 Byte Signed Integer Field Name: TIMEVARIANCE Data Element: INT4 Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: INT4 MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEVARIANCE
|
MMPUR_STR_HISTORYDETAILS-TIMEVARIANCEBYDELIEVERYDATE table field - 4 Byte Signed Integer
▼
Description: 4 Byte Signed Integer Field Name: TIMEVARIANCEBYDELIEVERYDATE Data Element: INT4 Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: INT4 MemoryID: AppClass: CP SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEVARIANCEBYDELIEVERYDATE
|
MMPUR_STR_HISTORYDETAILS-TIMEVARIANCEINPCT table field - Time Variance Percentage (length 4, scale 1)
▼
Description: Time Variance Percentage (length 4, scale 1) Field Name: TIMEVARIANCEINPCT Data Element: DEC4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEVARIANCEINPCT
|
MMPUR_STR_HISTORYDETAILS-TIMEVARIANCEINPCTBYDELIVDATE table field - Time Variance Percentage (length 4, scale 1)
▼
Description: Time Variance Percentage (length 4, scale 1) Field Name: TIMEVARIANCEINPCTBYDELIVDATE Data Element: DEC4 Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEVARIANCEINPCTBYDELIVDATE
|
MMPUR_STR_HISTORYDETAILS-TIMEVARIANCEINPCTWITHSIGN table field - Percentage packed with sign (+/-)
▼
Description: Percentage packed with sign (+/-) Field Name: TIMEVARIANCEINPCTWITHSIGN Data Element: KRPAC Data Type: DEC length (Dec): 4(1) Check table: Conversion Routine: Domain Name: PRZ31 MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEVARIANCEINPCTWITHSIGN
|
MMPUR_STR_HISTORYDETAILS-TIMEVARCINPCTWITHSIGNBYDD table field - Percentage packed with sign (+/-)
▼
Description: Percentage packed with sign (+/-) Field Name: TIMEVARCINPCTWITHSIGNBYDD Data Element: KRPAC Data Type: DEC length (Dec): 4(1) Check table: Conversion Routine: Domain Name: PRZ31 MemoryID: AppClass: ME SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEVARCINPCTWITHSIGNBYDD
|