SAP IFILEDGERCMPC table - Generated Table for View details in SAP
Show table
SAP IFILEDGERCMPC table summary Object Name: IFILEDGERCMPC Dictionary Type: Table viewDescription: Generated Table for View
Field list for IFILEDGERCMPC table on an S/4 SAP system
Details
IFILEDGERCMPC-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
IFILEDGERCMPC-LEDGER table field - Ledger in General Ledger Accounting
▼
Description: Ledger in General Ledger Accounting Field Name: LEDGER Data Element: FINS_LEDGER Data Type: CHAR length (Dec): 2(0) Check table: FINSC_LEDGER Conversion Routine: ALPHA Domain Name: FINS_LEDGER MemoryID: GLN_FLEX AppClass: SHLP: FINS_LEDGER SHLP Field: RLDNR ConvExit: ALPHA See all SAP tables containing field LEDGER
IFILEDGERCMPC-COMPANYCODE table field - Company Code
▼
Description: Company Code Field Name: COMPANYCODE Data Element: BUKRS Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: Domain Name: BUKRS MemoryID: BUK AppClass: FB SHLP: C_T001 SHLP Field: BUKRS ConvExit: See all SAP tables containing field COMPANYCODE
IFILEDGERCMPC-COMPANYCODENAME table field - Name of Company Code or Company
▼
Description: Name of Company Code or Company Field Name: COMPANYCODENAME Data Element: BUTXT Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: TEXT25 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field COMPANYCODENAME
IFILEDGERCMPC-CONTROLLINGAREA table field - Controlling Area
▼
Description: Controlling Area Field Name: CONTROLLINGAREA Data Element: KOKRS Data Type: CHAR length (Dec): 4(0) Check table: TKA01 Conversion Routine: Domain Name: CACCD MemoryID: CAC AppClass: KS SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONTROLLINGAREA
IFILEDGERCMPC-CHARTOFACCOUNTS table field - Chart of Accounts
▼
Description: Chart of Accounts Field Name: CHARTOFACCOUNTS Data Element: KTOPL Data Type: CHAR length (Dec): 4(0) Check table: T004 Conversion Routine: Domain Name: KTOPL MemoryID: KPL AppClass: FB SHLP: C_KTOPL SHLP Field: KTOPL ConvExit: See all SAP tables containing field CHARTOFACCOUNTS
IFILEDGERCMPC-CITYNAME table field - City
▼
Description: City Field Name: CITYNAME Data Element: ORT01 Data Type: CHAR length (Dec): 25(0) Check table: Conversion Routine: Domain Name: TEXT25 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field CITYNAME
IFILEDGERCMPC-CURRENCY table field - Currency Key
▼
Description: Currency Key Field Name: CURRENCY Data Element: WAERS Data Type: CUKY length (Dec): 5(0) Check table: TCURC Conversion Routine: Domain Name: WAERS MemoryID: FWS AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field CURRENCY
IFILEDGERCMPC-FISCALYEARVARIANT table field - Fiscal Year Variant
▼
Description: Fiscal Year Variant Field Name: FISCALYEARVARIANT Data Element: PERIV Data Type: CHAR length (Dec): 2(0) Check table: T009 Conversion Routine: Domain Name: PERIV MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field FISCALYEARVARIANT
Search SAP tables
View list of all SAP tables(S4H/ECC) Select data from SAP table