Details |
EWASSERVFREQTIMESLICE-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: * Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
EWASSERVFREQTIMESLICE-OBJNR table field - Number of service frequency
▼
Description: Number of service frequency Field Name: OBJNR Data Element: EOBJNR Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: ALPHA Domain Name: EOBJNR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field OBJNR
|
EWASSERVFREQTIMESLICE-LAUFNR table field - Sequence Number of Service Frequency
▼
Description: Sequence Number of Service Frequency Field Name: LAUFNR Data Element: LAUFNR Data Type: NUMC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: NUMC5 MemoryID: AppClass: VA SHLP: SHLP Field: ConvExit: See all SAP tables containing field LAUFNR
|
EWASSERVFREQTIMESLICE-BIS table field - Date at Which a Time Slice Expires
▼
Description: Date at Which a Time Slice Expires Field Name: BIS Data Element: BISZEITSCH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field BIS
|
EWASSERVFREQTIMESLICE-AB table field - Date from which time slice is valid
▼
Description: Date from which time slice is valid Field Name: AB Data Element: ABZEITSCH Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field AB
|
EWASSERVFREQTIMESLICE-TIMEFRAME table field - Service window
▼
Description: Service window Field Name: TIMEFRAME Data Element: TIMEFRAME Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: TIMEFRAME MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TIMEFRAME
|
EWASSERVFREQTIMESLICE-DATECHANGE table field - Service frequency can be changed
▼
Description: Service frequency can be changed Field Name: DATECHANGE Data Element: KENNZDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DATECHANGE
|
EWASSERVFREQTIMESLICE-STATUS_SERV table field - Service Status
▼
Description: Service Status Field Name: STATUS_SERV Data Element: STATUS_SERV Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: STATUS_SERV MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATUS_SERV
|
EWASSERVFREQTIMESLICE-STATUS_CUST table field - Customer Status
▼
Description: Customer Status Field Name: STATUS_CUST Data Element: STATUS_CUST Data Type: CHAR length (Dec): 2(0) Check table: * Conversion Routine: Domain Name: CUSTSTAT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STATUS_CUST
|
EWASSERVFREQTIMESLICE-STARTTIME table field - Start time of a service window
▼
Description: Start time of a service window Field Name: STARTTIME Data Element: START_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTTIME
|
EWASSERVFREQTIMESLICE-STOPTIME table field - End of service window
▼
Description: End of service window Field Name: STOPTIME Data Element: STOP_TIME Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field STOPTIME
|
EWASSERVFREQTIMESLICE-CONT_COUNT table field - Number of available containers
▼
Description: Number of available containers Field Name: CONT_COUNT Data Element: CONT_COUNT Data Type: INT4 length (Dec): 10(0) Check table: Conversion Routine: Domain Name: E_FAKTOR MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field CONT_COUNT
|
EWASSERVFREQTIMESLICE-ROUTE table field - Planned Waste Disposal Order Route
▼
Description: Planned Waste Disposal Order Route Field Name: ROUTE Data Element: EROUTE Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: ALPHA Domain Name: EROUTE MemoryID: EROUTE AppClass: SHLP: EROUTE_MAIN SHLP Field: ROUTE ConvExit: ALPHA See all SAP tables containing field ROUTE
|
EWASSERVFREQTIMESLICE-ROUTE_SEQUENCE table field - Number of stop in route
▼
Description: Number of stop in route Field Name: ROUTE_SEQUENCE Data Element: ROUTE_SEQUENCE Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: ALPHA Domain Name: SEQUENCE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field ROUTE_SEQUENCE
|
EWASSERVFREQTIMESLICE-DATE_CONCRETE table field - Date in CHAR format
▼
Description: Date in CHAR format Field Name: DATE_CONCRETE Data Element: DATE8 Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DATE_CONCRETE
|
EWASSERVFREQTIMESLICE-SEASON_FROM table field - Season start for waste disposal service
▼
Description: Season start for waste disposal service Field Name: SEASON_FROM Data Element: SEASON_FROM Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: MM_TT Domain Name: MMTT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: MM_TT See all SAP tables containing field SEASON_FROM
|
EWASSERVFREQTIMESLICE-SEASON_TO table field - Season end for waste disposal service
▼
Description: Season end for waste disposal service Field Name: SEASON_TO Data Element: SEASON_TO Data Type: CHAR length (Dec): 4(0) Check table: Conversion Routine: MM_TT Domain Name: MMTT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: MM_TT See all SAP tables containing field SEASON_TO
|
EWASSERVFREQTIMESLICE-CAL_ID table field - Factory Calendar
▼
Description: Factory Calendar Field Name: CAL_ID Data Element: WFCID Data Type: CHAR length (Dec): 2(0) Check table: * Conversion Routine: Domain Name: WFCID MemoryID: FCI AppClass: SCAL SHLP: SHLP Field: ConvExit: See all SAP tables containing field CAL_ID
|
EWASSERVFREQTIMESLICE-SFREPLACE table field - Indicator: override route using service frequency
▼
Description: Indicator: override route using service frequency Field Name: SFREPLACE Data Element: E_SF_REPLACE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field SFREPLACE
|
EWASSERVFREQTIMESLICE-WASTE_FLAG table field - Order Relevance
▼
Description: Order Relevance Field Name: WASTE_FLAG Data Element: WASTE_FLAG Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: EWAORDER_RELEVANT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WASTE_FLAG
|
EWASSERVFREQTIMESLICE-GGVERTRAG table field - Guarantor Contract
▼
Description: Guarantor Contract Field Name: GGVERTRAG Data Element: E_GUARANTOR_CONTRACT Data Type: CHAR length (Dec): 18(0) Check table: Conversion Routine: ALPHA Domain Name: E_GUARANTOR_CONTRACT MemoryID: EWAGCONTRACT AppClass: SHLP: EWA_GUARANTOR_CONTRACT_MAIN SHLP Field: GCONTRACT ConvExit: ALPHA See all SAP tables containing field GGVERTRAG
|
EWASSERVFREQTIMESLICE-ROUTE_LFNR table field - Consecutive Number of Service for Route
▼
Description: Consecutive Number of Service for Route Field Name: ROUTE_LFNR Data Element: ROUTE_LFNR Data Type: NUMC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: NUMC5 MemoryID: AppClass: VA SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUTE_LFNR
|
EWASSERVFREQTIMESLICE-ROUTE_BIS table field - To Date of Service for Route
▼
Description: To Date of Service for Route Field Name: ROUTE_BIS Data Element: ROUTE_BISDAT Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field ROUTE_BIS
|
EWASSERVFREQTIMESLICE-CAPACITYKIND table field - Capacity Category
▼
Description: Capacity Category Field Name: CAPACITYKIND Data Element: EWA_CAPACITYKIND Data Type: CHAR length (Dec): 20(0) Check table: Conversion Routine: ALPHA Domain Name: EWA_CAPACITYKIND MemoryID: AppClass: SHLP: SHLP Field: ConvExit: ALPHA See all SAP tables containing field CAPACITYKIND
|
EWASSERVFREQTIMESLICE-SERVICE_GROUP table field - Service Grouping
▼
Description: Service Grouping Field Name: SERVICE_GROUP Data Element: SERVICE_GROUP Data Type: CHAR length (Dec): 6(0) Check table: * Conversion Routine: Domain Name: SERVICE_GROUP MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field SERVICE_GROUP
|
EWASSERVFREQTIMESLICE-PLANNED_TIME table field - Time Planned
▼
Description: Time Planned Field Name: PLANNED_TIME Data Element: PLDTIM Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: UZEIT MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNED_TIME
|
EWASSERVFREQTIMESLICE-PLANNED_DURT table field - Service Duration
▼
Description: Service Duration Field Name: PLANNED_DURT Data Element: SERVDUR Data Type: TIMS length (Dec): 6(0) Check table: Conversion Routine: Domain Name: TIMES MemoryID: AppClass: PP SHLP: SHLP Field: ConvExit: See all SAP tables containing field PLANNED_DURT
|
EWASSERVFREQTIMESLICE-WEEKLY table field - Weekly Service Interval
▼
Description: Weekly Service Interval Field Name: WEEKLY Data Element: WEEKLY Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: RYTHMUS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field WEEKLY
|
EWASSERVFREQTIMESLICE-MONTHLY table field - Day in Month for Service
▼
Description: Day in Month for Service Field Name: MONTHLY Data Element: MONTHLY Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MONTHLY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MONTHLY
|
EWASSERVFREQTIMESLICE-MONTH_COUNT table field - Frequency of Service in Months
▼
Description: Frequency of Service in Months Field Name: MONTH_COUNT Data Element: MONTH_COUNT Data Type: CHAR length (Dec): 2(0) Check table: Conversion Routine: Domain Name: MONTH_COUNT MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MONTH_COUNT
|
EWASSERVFREQTIMESLICE-FLAG1 table field - Indicators
▼
Description: Indicators Field Name: FLAG1 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG1
|
EWASSERVFREQTIMESLICE-FLAG2 table field - Indicators
▼
Description: Indicators Field Name: FLAG2 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG2
|
EWASSERVFREQTIMESLICE-FLAG3 table field - Indicators
▼
Description: Indicators Field Name: FLAG3 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG3
|
EWASSERVFREQTIMESLICE-FLAG4 table field - Indicators
▼
Description: Indicators Field Name: FLAG4 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG4
|
EWASSERVFREQTIMESLICE-FLAG5 table field - Indicators
▼
Description: Indicators Field Name: FLAG5 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG5
|
EWASSERVFREQTIMESLICE-FLAG6 table field - Indicators
▼
Description: Indicators Field Name: FLAG6 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG6
|
EWASSERVFREQTIMESLICE-FLAG7 table field - Indicators
▼
Description: Indicators Field Name: FLAG7 Data Element: KENNZX Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: KENNZX MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field FLAG7
|
EWASSERVFREQTIMESLICE-STARTDATE table field - Date on Which Waste Disposal Service Begins
▼
Description: Date on Which Waste Disposal Service Begins Field Name: STARTDATE Data Element: START Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field STARTDATE
|
EWASSERVFREQTIMESLICE-EWEEKDAY table field - Weekday of Service
▼
Description: Weekday of Service Field Name: EWEEKDAY Data Element: EWEEKDAY Data Type: NUMC length (Dec): 1(0) Check table: Conversion Routine: Domain Name: SC_WEEKDAY MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field EWEEKDAY
|
EWASSERVFREQTIMESLICE-DAY_FREQUENCY table field - Daily Frequency
▼
Description: Daily Frequency Field Name: DAY_FREQUENCY Data Element: DYFRQ Data Type: NUMC length (Dec): 3(0) Check table: Conversion Routine: Domain Name: DYFRQ MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field DAY_FREQUENCY
|
EWASSERVFREQTIMESLICE-TSL_GUID table field - Link GUID
▼
Description: Link GUID Field Name: TSL_GUID Data Element: WLGUID Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: SYSUUID_22 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field TSL_GUID
|