CMMSPQTCMMDTYQTY-VALIDITYENDDATE table field - End of Validity Period ▼
Description: End of Validity Period Field Name: VALIDITYENDDATE Data Element: KDATE Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit:
CMMSPQTCMMDTYQTY-VALIDITYSTARTDATE table field - Start of Validity Period ▼
Description: Start of Validity Period Field Name: VALIDITYSTARTDATE Data Element: KDATB Data Type: DATS length (Dec): 8(0) Check table: Conversion Routine: Domain Name: DATUM MemoryID: AppClass: TEST SHLP: SHLP Field: ConvExit:
CMMSPQTCMMDTYQTY-COMMODITYUNIT table field - Purchase Order Unit of Measure ▼
Description: Purchase Order Unit of Measure Field Name: COMMODITYUNIT Data Element: BSTME Data Type: UNIT length (Dec): 3(0) Check table: * Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT
CMMSPQTCMMDTYQTY-PURGDOCCMMDTYREFDOCITMQTY table field - Price unit ▼
Description: Price unit Field Name: PURGDOCCMMDTYREFDOCITMQTY Data Element: EPEIN Data Type: DEC length (Dec): 5(0) Check table: Conversion Routine: Domain Name: DEC5 MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit:
CMMSPQTCMMDTYQTY-ITEMQUANTITYUNIT table field - Purchase Order Unit of Measure ▼
Description: Purchase Order Unit of Measure Field Name: ITEMQUANTITYUNIT Data Element: BSTME Data Type: UNIT length (Dec): 3(0) Check table: * Conversion Routine: CUNIT Domain Name: MEINS MemoryID: AppClass: MG SHLP: SHLP Field: ConvExit: CUNIT