Details |
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGRITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PGRITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMPPOITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPPOITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMPPOITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPPOITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOITEMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PGRITMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURREQITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURREQITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCLGRDTL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLGRDTL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCLPOALL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLPOALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCLPODTL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLPODTL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCMSGDET-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCMSGDET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOACCRRVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOACCRRVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRSSPITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSSPITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCLINVDTL-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLINVDTL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMCPOIMONI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMCPOIMONI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPRITEMMNTR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRITEMMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURREQNITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURREQNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITEMPAI4-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMPAI4 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITEMPAI6-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMPAI6 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDITMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURORDITMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURORDITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURCONTRITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCONTRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCSIMPACTED-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCSIMPACTED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURORDSPND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURORDSPND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICPURORDITMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPURORDITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMAINTORDCOMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNITMWD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESPURORD_VH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESPURORD_VH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOHISTACCT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOHISTACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMASSUPDATE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMASSUPDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPRSSPITEMEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPRSSPITEMEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CDOCLPRDETAILS-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCLPRDETAILS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURORDQUERY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURORDQUERY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURORDVALUE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURORDVALUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPDOCLOVERVIEW-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPDOCLOVERVIEW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTREFDOC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTREFDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMASUPDTNODE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMASUPDTNODE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMASUPDTSTRT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMASUPDTSTRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURGDOCITMINV-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCITMINV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDITEMENH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITEMENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNITEMWD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITEMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCTRMASSCHANGE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCTRMASSCHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITMACT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGDOCITMINV-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGDOCITMINV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSUPINVCITMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSUPINVCITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCNTRLPCONITMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCNTRLPCONITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCTRITMMASSUPDT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRITMMASSUPDT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMASUPDPURORDVH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMASUPDPURORDVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMASUPDSRVPRFVH-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMASUPDSRVPRFVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURGSPNDCOMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURGSPNDCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURORDVALUEQ-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURORDVALUEQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURSPNDCOMP3-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURSPNDCOMP3 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURGDOCITEMSPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCITEMSPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURGDOCITEMSPR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCITEMSPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDITEMMONI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITEMMONI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDREFDOCIR-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCIR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDREFDOCPC-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCPC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDREFDOCPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDREFDOCPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDSUPLCONF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDSUPLCONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLPCONITMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCONITMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESSERVPERFSVH-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESSERVPERFSVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSHTITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSHTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPURSPENDCOMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURSPENDCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITEMALL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITEMALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOSPNDACTLFUTR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSPNDACTLFUTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGACTFUTSPND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGACTFUTSPND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCTRMAINTAINITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRMAINTAINITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMSRVCPERFRMRVH-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMSRVCPERFRMRVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOIQTYVALDCCALC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOIQTYVALDCCALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOITMMASSUPDATE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOITMMASSUPDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTREFDOCVH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTREFDOCVH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINTVHSERPRF-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINTVHSERPRF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOSUPLRCONFMAIN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSUPLRCONFMAIN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOVALPLNDVSACTL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOVALPLNDVSACTL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURGDOCITEMSOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURGDOCITEMSOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVCENTRSH000WD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVCENTRSH000WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURCHASECT000WD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCHASECT000WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURCONTRITEMAPI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCONTRITEMAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVCENTRSH000TP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVCENTRSH000TP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
M_VMMP_SES_H_EOP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP M_VMMP_SES_H_EOP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITMDRAFT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMDRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTREFDOCAL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTREFDOCAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SHSMSRVENTSHTLIT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SHSMSRVENTSHTLIT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBAN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBAV-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKES-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARESB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARESB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DRSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBAN1-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBANU-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBANU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBANW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBANW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBEFU-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBEFU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKESU-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKESU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FEBAN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FEBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPOAO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOAO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESBB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESBB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESBD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESBD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESBK-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESBK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UEBAN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UEBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UEKES-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UEKES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
UEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP UEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CN_RES-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CN_RES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DIRESB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIRESB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSEG3-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSEG3 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IOGOMO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOGOMO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MATDOC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MATDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MCRSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCRSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MDSB_X-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MDSB_X table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OIASEE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OIASEE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OIASFF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OIASFF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESB01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESB01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESB04-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESB04 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BDIEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BDIEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FUSS_MB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FUSS_MB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GRIRPOS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GRIRPOS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSEGVB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSEGVB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MSEGEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MSEGEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OIAMSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OIAMSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
REFEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REFEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESBD_P-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESBD_P table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BADI_EKP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BADI_EKP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BADI_POT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BADI_POT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COMPMOVE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COMPMOVE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBAN_MEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN_MEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBAN_VSR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN_VSR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKPODATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPODATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EXPD_OBJ-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_OBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GRIR_ACC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GRIR_ACC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GRIR_BZN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GRIR_BZN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GRIR_LIF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GRIR_LIF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IOOPCOMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOOPCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IOOPGOMO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOOPGOMO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IOSOGOMO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOSOGOMO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MASSEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPO1211-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPO1211 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITEM1-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RESBDGET-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RESBDGET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RFRMMSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RFRMMSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_EKES-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_EKES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_EKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_EKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_MSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_MSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COWB_COMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COWB_COMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDGR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDGR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSCPURDOC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSCPURDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBEFU_SRV-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBEFU_SRV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKPO_PO_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPO_PO_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EXPD_LINE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSH_ETS_S-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSH_ETS_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUT_ABT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUT_ABT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPI_EBAN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPI_EBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPOITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPOITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQ3319-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQ3319 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOREQFLD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOREQFLD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PREQ_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQ_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PREQ_ITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQ_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCJ_RESBD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCJ_RESBD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIGSII_W-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIGSII_W table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ABSOSRVITM-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: BUT000 Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ABSOSRVITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVCONITM-SERVICEPERFORMER table field - Partner Number
▼
Description: Partner Number Field Name: SERVICEPERFORMER Data Element: CRMT_PARTNER_NO Data Type: CHAR length (Dec): 32(0) Check table: Conversion Routine: Domain Name: CRM_PARTNER_NO MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVCONITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVORDITM-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: BUT000 Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVORDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BADI_IMSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BADI_IMSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CEXTPRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CEXTPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CN10_RESBD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CN10_RESBD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COBL_MRM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COBL_MRM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPCHIERITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCHIERITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORD_VH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORD_VH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DRSEG_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRSEG_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EINR_S_POT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EINR_S_POT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EXPD_INPUT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_INPUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EXTREQBANF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXTREQBANF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FNDEIFEBAN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFEBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FNDEIFEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMATDOCREC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCREC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMSEG_CORU-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSEG_CORU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPOCONFAPI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPOCONFAPI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUT_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQ_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQ_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PGRITEMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PGRITEMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITEMENH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURORDITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PREQ_ITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PREQ_ITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RIHFCOM_XL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RIHFCOM_XL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VAR_GOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VAR_GOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPRITMDEX-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPRITMDEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EKPO_SPLITT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EKPO_SPLITT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FCMLREPEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FCMLREPEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMATDOCITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITMAPI01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITMAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURREQNITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURREQNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISUPPLCONFL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUPPLCONFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MBBAPI_RESB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MBBAPI_RESB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MECONF_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MECONF_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUT_ITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUT_ITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQ_ITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQ_ITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPO_S_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPO_S_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_S_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_S_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_V_MSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_V_MSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PENHCPURORD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PENHCPURORD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMCPOIMONI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCPOIMONI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMO_MSEG_S-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMO_MSEG_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOIENHCD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOIENHCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PORDER_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PORDER_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PORDER_ITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PORDER_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURORDITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURREQNITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQNITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSEISRESB01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSEISRESB01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_GR_ITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_GR_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
VFCLMMMEKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VFCLMMMEKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_MD_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_MD_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_PO_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_PO_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/S_EKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_EKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCMB/S_MSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMB/S_MSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVQTANITEM-SERVICEPERFORMER table field - Business Partner Number
▼
Description: Business Partner Number Field Name: SERVICEPERFORMER Data Element: BU_PARTNER Data Type: CHAR length (Dec): 10(0) Check table: BUT000 Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVQTANITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEPOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEPOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CKEX2_F_GICR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CKEX2_F_GICR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CKEX2_F_POCR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CKEX2_F_POCR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CKEX2_F_RESV-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CKEX2_F_RESV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_S_BO_PR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_BO_PR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_S_SP_PR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_SP_PR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FRM_EKPOVB_T-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FRM_EKPOVB_T table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMATDOCITEM2-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCITEM2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITEMAPI01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRITEMBASIC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRITEMBASIC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IREPPOITMENH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IREPPOITMENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPO1211GRID-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPO1211GRID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MILL_WAWE_LZ-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MILL_WAWE_LZ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMCPOIMONI1-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMCPOIMONI1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOICURVAL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOICURVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOIDSTACK-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOIDSTACK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGORDENCD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGORDENCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURCTR_ITM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCTR_ITM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURREQNITM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURREQNITM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2MEPOITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2MEPOITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURORDERITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURORDERITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ARUN_EKES_UPD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ARUN_EKES_UPD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEOUTITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEOUTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEPOITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEPOITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEREQITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEREQITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CGBPRMAINTITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CGBPRMAINTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPOSERSPNDQ-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPOSERSPNDQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOSUPLRCONFD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOSUPLRCONFD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DRAFT_PR_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: PR_SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRAFT_PR_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPMEPOITEM1-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPMEPOITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPMEPOITEMX-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPMEPOITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICNTRLPCONITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICNTRLPCONITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMATDOCNOTREV-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCNOTREV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPOSCHEDENH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPOSCHEDENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMSESITAPI01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMSESITAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
INMATLDOCLIST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INMATLDOCLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPDSCHLINEEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPDSCHLINEEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRMTHBPRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MECONF_DETAIL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MECONF_DETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUTBAPIITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUTBAPIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUTBAPIITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUTBAPIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPO1211_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPO1211_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPOITEM_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPOITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQBAPIITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQBAPIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQBAPIITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQBAPIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_HCM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_HCM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_D_MTDCSA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_D_MTDCSA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_MIG_MSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_MIG_MSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PANAHUBPOMIGR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PANAHUBPOMIGR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOFUTRSPND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOFUTRSPND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOSCHEACCT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOSCHEDENH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEDENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOSCHEDFUT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEDFUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMSPNDASSGMT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMSPNDASSGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITMSERSPND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITMSERSPND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPORDITEMCALC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPORDITEMCALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURORDITMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURREQITMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURORDITMTP_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURORDITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RCNTRLPCONITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCNTRLPCONITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPSLL/EKPO_S-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPSLL/EKPO_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADPIC_S_GOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADPIC_S_GOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADPIC_S_POITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADPIC_S_POITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEOUTITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEOUTITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEREQITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEREQITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BBPIV_DRSEG_CO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BBPIV_DRSEG_CO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CNTRLPCITMTP_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CNTRLPCITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPURORDITMTP_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPURORDITMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSSPPRMAINTITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSSPPRMAINTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPMEOUTITEM1-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPMEOUTITEM1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
E1BPMEOUTITEMX-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP E1BPMEOUTITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EBAN_SSP_ITM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: PR_SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EBAN_SSP_ITM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EXPD_EKPO_LINE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXPD_EKPO_LINE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EXP_INPUT_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXP_INPUT_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GRIR_LIST_HEAD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GRIR_LIST_HEAD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
GRIR_LIST_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GRIR_LIST_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPOITEMAPI01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPOITEMAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURGDOCITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURGDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRCHBPOIAPI01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRCHBPOIAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
LOIN_S_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP LOIN_S_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MECONF_DETAILX-SERVICEPERFORMER table field - Boolean type
▼
Description: Boolean type Field Name: SERVICEPERFORMER Data Element: MMPUR_BOOL Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: CHAR1 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MECONF_DETAILX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPOITEM_DATAX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPOITEM_DATAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQ3211_GRID-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQ3211_GRID table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_D_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_D_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPURUI_PR_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPURUI_PR_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_ANA_EKET-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_ANA_EKET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_EBAN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EBAN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_EXT_EKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_EXT_EKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SUPCONFD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SUPCONFD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MSR_S_RPO_EKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MSR_S_RPO_EKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFUTSCHPOENTND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFUTSCHPOENTND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPDCNVRTDVAL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPDCNVRTDVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOCNVRTDVAL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOCNVRTDVAL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOIACCASGMT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOIACCASGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOSCHEDACCT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOSCHEDACCT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPURSPNDCOMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURSPNDCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMNTPLGBKTCOMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMNTPLGBKTCOMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURREQNITMOVW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQNITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURGDOCITEMROW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURGDOCITEMROW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURGORDITEMROW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURGORDITEMROW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RMMPURGDOCITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMMPURGDOCITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
SESLEANITEMROW-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SESLEANITEMROW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_ME_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_ME_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ADPIC_S_POITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADPIC_S_POITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
APURCHASECTRITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP APURCHASECTRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ASRVCENTRSHTITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ASRVCENTRSHTITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLIST_COMP_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLIST_COMP_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURREQWFLEML-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURREQWFLEML table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPCHIERITMOBJPG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPCHIERITMOBJPG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CPOMAINHEADLIST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPOMAINHEADLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ICPURGDOCSLENCD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICPURGDOCSLENCD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGOODSISUDOCLST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGOODSISUDOCLST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMCPURORDRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMCPURORDRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURCHASECTRITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURCHASECTRITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISU_CHECK_BWTAR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISU_CHECK_BWTAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MATERIAL_DETAIL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MATERIAL_DETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUT_ITEM_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUT_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MILL_ISSUE_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MILL_ISSUE_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_S_ITEM_SRV-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_S_ITEM_SRV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCMMPURORDVALUE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCMMPURORDVALUE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PCNTRLPURORDITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCNTRLPURORDITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PFACRA_ACRPOOBJ-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PFACRA_ACRPOOBJ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOIACCASGMT1-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOIACCASGMT1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOIACCASGMT2-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOIACCASGMT2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPURSPNDCOMP1-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURSPNDCOMP1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPURSPNDCOMP2-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPURSPNDCOMP2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITEMCASTDAMT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITEMCASTDAMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOMAINTITMLIST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOMAINTITMLIST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOSCHFUTREXTND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOSCHFUTREXTND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPROPENQUANCALC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPROPENQUANCALC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGACTFUTENTD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGACTFUTENTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURGDOCITEMSPR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURGDOCITEMSPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURORDITEMMNTR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITEMMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURREQITEMMNTR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURREQITEMMNTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSHLP_RESBBT_ST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSHLP_RESBBT_ST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSUPLRINVITMOVW-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSUPLRINVITMOVW table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_SC_CONTEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_SC_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_SC_CONTEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_SC_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_SC_CONTEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_SC_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_SC_CONTEXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_SC_CONTEXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_ALV_MD_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_ALV_MD_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_ALV_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_ALV_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WSUBST_EKPO_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WSUBST_EKPO_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/CS_EXLST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/CS_EXLST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMECONFDETAIL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMECONFDETAIL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMEREQITEMIMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMEREQITEMIMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CCTRMAINTITMHIER-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCTRMAINTITMHIER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMATDOCPRINTGISC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATDOCPRINTGISC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMATDOCPRINTGMVT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMATDOCPRINTGMVT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPOSERVICESPND-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPOSERVICESPND table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMPURCONTITMDEX-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMPURCONTITMDEX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMSPLRCMPURVAL2-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMSPLRCMPURVAL2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CMMTIMESHEETDATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMMTIMESHEETDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COWB_S_COMPONENT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COWB_S_COMPONENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CSRVENSHITMATTRI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CSRVENSHITMATTRI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CTRLPURREQWFLEML-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRLPURREQWFLEML table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFS_BAPIMEPOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFS_BAPIMEPOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FNDEIFMM_SES_ITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFMM_SES_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IGOODSRCPTDOCLST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IGOODSRCPTDOCLST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMATDOCREC4PRINT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMATDOCREC4PRINT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURCHORDRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURCHORDRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IMMPURORDITEMENH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMMPURORDITEMENH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPRMTHBPRITAPI01-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRMTHBPRITAPI01 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPROCMTHUBPRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPROCMTHUBPRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IPURGDOCSUPLCONF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPURGDOCSUPLCONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCHEDGAGRMTENHD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCHEDGAGRMTENHD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISESPURORDITM_VH-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISESPURORDITM_VH table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISRVENTSHTITMBSC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISRVENTSHTITMBSC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MASSEKPOCONTRACT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSEKPOCONTRACT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MASSEKPOSCHAGREE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MASSEKPOSCHAGREE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MECONF_BAPI_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MECONF_BAPI_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUTBAPIITEMALL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUTBAPIITEMALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUTBAPIITEMALL-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUTBAPIITEMALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEOUT_ITEM_DATAX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEOUT_ITEM_DATAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_D_ACCASS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_D_ACCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_K-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_ANAEXTEKET-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_ANAEXTEKET table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PRINT_EKPO-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PRINT_EKPO table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SUPCONFD_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SUPCONFD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_ITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_REQNITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_REQNITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_MM_CHK_LOGR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_MM_CHK_LOGR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_V_MDOC_EKKN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_V_MDOC_EKKN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OUTL_AGRMNT_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OUTL_AGRMNT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OUTL_AGRMNT_ITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OUTL_AGRMNT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMBACKLOGSERVUNI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMBACKLOGSERVUNI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PMMPOITMACCASGMT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMMPOITMACCASGMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POAC_EKPO_BUFFER-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POAC_EKPO_BUFFER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPOITMCONVRTDAMT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPOITMCONVRTDAMT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURCTRHIERDRFRN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURCTRHIERDRFRN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPURORDITMIMPCTD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPURORDITMIMPCTD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSCHDLNMIGRATION-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSCHDLNMIGRATION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIS_GEN_EBAN_NP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIS_GEN_EBAN_NP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIS_GEN_EBAN_PR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIS_GEN_EBAN_PR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIS_GEN_EKPO_NP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIS_GEN_EKPO_NP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSIS_GEN_EKPO_PR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSIS_GEN_EKPO_PR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PURCHASECTRITM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PURCHASECTRITM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RM08RL88_SES_ITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RM08RL88_SES_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
RMMPURCHORDRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RMMPURCHORDRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_GR_GRN_BADI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_GR_GRN_BADI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WB2_V_CCS_MATDOC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WB2_V_CCS_MATDOC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/INV_S_MSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/INV_S_MSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/BEV1/NEXMEPOITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /BEV1/NEXMEPOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPIMECONFDETAILX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPIMECONFDETAILX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COWB_COMP_WIPB_RT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COWB_COMP_WIPB_RT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEPO1211GRID_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEPO1211GRID_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQBAPIITEMDATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQBAPIITEMDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MEREQBAPIITEMDATA-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MEREQBAPIITEMDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPO_DRAFT_S_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPO_DRAFT_S_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OCI_ITM_MAP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OCI_ITM_MAP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_S_IMSEG3_SRV-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_S_IMSEG3_SRV table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSHLP_MATERIAL_ST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSHLP_MATERIAL_ST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_PCON_EKPO_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCON_EKPO_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POTB_EKPO_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POTB_EKPO_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCWM/BAPIMEPOITEM-SERVICEPERFORMER table field -
▼
Description: Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCWM/BAPIMEPOITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SYCLO/MM_MSEG_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/MM_MSEG_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SYCLO/PM_RESB_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_RESB_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FIRU_GTD_MSEG_BADI-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FIRU_GTD_MSEG_BADI table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IBAPI_RESBD_UPDATE-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IBAPI_RESBD_UPDATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMDA_PUR_LTY_UEKES-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMDA_PUR_LTY_UEKES table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PR_S_PC_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PR_S_PC_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_DATA_HCM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_DATA_HCM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_UPL_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_UPL_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_PR_HUB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_PR_HUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PC_ITM_WFL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PC_ITM_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PSHLP_TREX_RESB_ST-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSHLP_TREX_RESB_ST table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ROIO_GR_CROSS_DOCK-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ROIO_GR_CROSS_DOCK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SCWM/BAPIMEPOITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCWM/BAPIMEPOITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
IWOS_COMPLETE_ORDER-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWOS_COMPLETE_ORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPO_DRAFT_S_ITEM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPO_DRAFT_S_ITEM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_DOCLST_GRITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_DOCLST_GRITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_DOCLST_POITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_DOCLST_POITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_DOCLST_SIITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_DOCLST_SIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SCH_AGRM_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SCH_AGRM_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SCH_AGRM_ITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SCH_AGRM_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SPPR_ITEM_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SPPR_ITEM_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CPO_ITM_WFL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CPO_ITM_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_LOCALPR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LOCALPR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_LCL_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_LCL_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SES_ITM_WFL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SES_ITM_WFL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSP_PR_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSP_PR_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OUTLINE_AGRMNT_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OUTLINE_AGRMNT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OUTLINE_AGRMNT_ITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OUTLINE_AGRMNT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PIC_ITEM_CHANGE_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PIC_ITEM_CHANGE_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
POAC_PO_ITEM_BUFFER-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP POAC_PO_ITEM_BUFFER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPSLL/IMSEGVB_R3_S-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPSLL/IMSEGVB_R3_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLIST_COMPONENT_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLIST_COMPONENT_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DIMP_ISU_CHECK_BWTAR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIMP_ISU_CHECK_BWTAR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EWASPURCHASEORDERPOS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASPURCHASEORDERPOS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_DRSEG_FLAT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_DRSEG_FLAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_DRAFT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_DRAFT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_DOCLST_REQITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_DOCLST_REQITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
NSDM_S_MTDCSA_NONKEY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP NSDM_S_MTDCSA_NONKEY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_SLS_PUR_VND_CONF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_SLS_PUR_VND_CONF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNITEM_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SI_MM_ITEM_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SI_MM_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SI_MM_ITEM_DATA-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SI_MM_ITEM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SI_MM_RINS_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SI_MM_RINS_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SI_MM_RINS_DATA-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SI_MM_RINS_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/STTPEC/S_TRN_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /STTPEC/S_TRN_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
COCB_MSD_S_COMH_IMSEG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCB_MSD_S_COMH_IMSEG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CRMS_MKTPL_MEREQ_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRMS_MKTPL_MEREQ_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DFS_ORDER_COMPONENT_S-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DFS_ORDER_COMPONENT_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_S_NAV_PR_ID_ATTR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_NAV_PR_ID_ATTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEORDERITEMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEORDERITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_PO_REF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_PO_REF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_ODATA_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_ODATA_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PSA_BASICDATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PSA_BASICDATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SOC_REQN_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SOC_REQN_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TSPURCHASEREQNITEM_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSPURCHASEREQNITEM_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SYCLO/MM_PO_ITEMS_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/MM_PO_ITEMS_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_DRAFT_K-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_DRAFT_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_AGMT_ITM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_AGMT_ITM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PR_RPL_DETAILS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PR_RPL_DETAILS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OUTLINE_AGREEMENT_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OUTLINE_AGREEMENT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
OUTLINE_AGREEMENT_ITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OUTLINE_AGREEMENT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_PCON_DATA_EKPO_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCON_DATA_EKPO_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATA_EKPO_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_EKPO_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/OE_S_PO_ITEM_API-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/OE_S_PO_ITEM_API table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/CS_EXLST_BUFFER-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/CS_EXLST_BUFFER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/EBAN_MAT_PRPL_S-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/EBAN_MAT_PRPL_S table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/ME_WO_COMPONENT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/ME_WO_COMPONENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/WOUPS_COMPONENT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/WOUPS_COMPONENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_S_BO_ORD_OPER_COMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_BO_ORD_OPER_COMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_S_SP_ORD_OPER_COMP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_SP_ORD_OPER_COMP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FSH_PO_MASS_CHANGE_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FSH_PO_MASS_CHANGE_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEORDERITEMTP_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEORDERITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_DRSEG_CO_FLAT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_DRSEG_CO_FLAT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_AGMT_ITMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_AGMT_ITMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PO_ITEMS_TEMPLATE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PO_ITEMS_TEMPLATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_PR_ITEMS_TEMPLATE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER_MEREQ Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_PR_ITEMS_TEMPLATE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_ITM_CHANGE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_ITM_CHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CTR_ITEM_IMPORT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CTR_ITEM_IMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXT_LCL_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXT_LCL_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PO_INFO_FOR_HCM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_INFO_FOR_HCM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSPPR_ITM_CHECK-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSPPR_ITM_CHECK table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
TDS_ME_OA_REPLD_PO_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TDS_ME_OA_REPLD_PO_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ACCGO/OE_S_PO_ITEMX_API-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ACCGO/OE_S_PO_ITEMX_API table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_ALM_ORDER_COMPONENT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_ALM_ORDER_COMPONENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BBPS_ER_EXT_PURCHASE_REQ-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BBPS_ER_EXT_PURCHASE_REQ table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
CLIST_API_COMPONENT_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CLIST_API_COMPONENT_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAM_SERVPROC_RESB_FIELDS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_SERVPROC_RESB_FIELDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEORDERITEMTP_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEORDERITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_CENTRAL_PURCHASING-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_CENTRAL_PURCHASING table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTITEMX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTITEMX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXTX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXTX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_CCTR_ITEM_IMPORT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_CCTR_ITEM_IMPORT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXTR_PR_DATA_HUB-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_PR_DATA_HUB table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_ITEM_ACCOUNT_INT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ITEM_ACCOUNT_INT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_OA_ITEM_CCTR_REF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_OA_ITEM_CCTR_REF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_OA_ITEM_CCTR_REF-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_OA_ITEM_CCTR_REF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_SSPPR_ITM_CHANGE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_SSPPR_ITM_CHANGE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPSFC_OBJECT_RESBD_P_PDF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPSFC_OBJECT_RESBD_P_PDF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SP_MM_CONTRACT_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SP_MM_CONTRACT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/WOUPS_COMPONENT_X-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/WOUPS_COMPONENT_X table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAM_S_ALM_ORDER_COMPONENT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_ALM_ORDER_COMPONENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
FRM_GR_EKPO_EXTENDED_TYPE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FRM_GR_EKPO_EXTENDED_TYPE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD1-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD1 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD2-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD2 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETITEMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISU_CHARGE_KLASSIFIZIEREN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISU_CHARGE_KLASSIFIZIEREN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_EXTR_LOCALPR_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_EXTR_LOCALPR_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PURCHASEORDERITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PURCHASEORDERITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_PCON_DATA_AC_COSI_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCON_DATA_AC_COSI_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_PCTR_PO_DOC_ITEMS_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_PCTR_PO_DOC_ITEMS_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATA_AC_POSI_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSI_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_ALM_ORDER_COMPONENT_E-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_ALM_ORDER_COMPONENT_E table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMBSI_SRM_CONTRT_PARAM_STU-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMBSI_SRM_CONTRT_PARAM_STU table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_PO_REF_DEEP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_PO_REF_DEEP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_WITH_PO_REF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_WITH_PO_REF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_ANA_DIMENSION_ATTR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_ANA_DIMENSION_ATTR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PO_CONF_UPD_FIELDS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PO_CONF_UPD_FIELDS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
PPSFC_OBJECT_RESBD_P_S_PDF-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPSFC_OBJECT_RESBD_P_S_PDF table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATA_AC_POSIG_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSIG_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/ISDFPS/FOLLOW_OUTTAB_ORDER-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/FOLLOW_OUTTAB_ORDER table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MERP/MM_PO_ITEM_ENTITY_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/MM_PO_ITEM_ENTITY_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
BAPI_ALM_ORDER_COMPONENT_UP-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP BAPI_ALM_ORDER_COMPONENT_UP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD1_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD1_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD2_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD2_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASECONTRACTITEMWD_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASECONTRACTITEMWD_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETITEMTP_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OCI_ITM_TO_DRAFT_ITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OCI_ITM_TO_DRAFT_ITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTBAPIITEM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTBAPIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTBAPIITEM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTBAPIITEM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTITMEMALL-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTITMEMALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTITMEMALL-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTITMEMALL table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTITM_DATA-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTITM_DATA table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_CHG-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_CHG table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_CRT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_CRT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_MAX-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_MAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_OUT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_OUT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SPROC_S_MATDOC_ACCASS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SPROC_S_MATDOC_ACCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATA_AC_POSCHE_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSCHE_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SP_MAPPED_ITEMS_MM_EXT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SP_MAPPED_ITEMS_MM_EXT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAM_S_ALM_ORDER_COMPONENT_UP-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_ALM_ORDER_COMPONENT_UP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCENTRALPURCHASEORDERITEMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASEORDERITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEREQUISITIONITEM_WD-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_WD table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISSERVICEENTRYSHEETITEMTP_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISSERVICEENTRYSHEETITEMTP_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ACCOUNT_ASSIGNMENT-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ACCOUNT_ASSIGNMENT table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ITEM_PO_REF_ACCASS-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ITEM_PO_REF_ACCASS table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_OUTLINE_MEOUTITM_DATAX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_OUTLINE_MEOUTITM_DATAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXTX_MAX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXTX_MAX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_SES_ITEM_BOPF_EXT_CRTX-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_SES_ITEM_BOPF_EXT_CRTX table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATA_AC_POSCHEG_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_AC_POSCHEG_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_GRIDROW_AC_POSI_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_AC_POSI_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_GRIDROW_POSCHEG_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_POSCHEG_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SP_BAPIMEOUTITEM_EXT_MM-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SP_BAPIMEOUTITEM_EXT_MM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MERP/MM_RESV_ITEM_ENTITY_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/MM_RESV_ITEM_ENTITY_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MERP/PM_WOCOMPMNT_ENTITY_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_WOCOMPMNT_ENTITY_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EWASSUBCONTR_PO_DATA_POSITION-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASSUBCONTR_PO_DATA_POSITION table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCHASECONTRACTITEMTP-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCHASECONTRACTITEMTP table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISU_CHARGE_KLASSIFIZIEREN_CFC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISU_CHARGE_KLASSIFIZIEREN_CFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_GRIDROW_AC_POSIG_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_AC_POSIG_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/DMBE/SP_BAPIMEOUTITEMX_EXT_MM-SERVICEPERFORMER table field - Updated information in related user data field
▼
Description: Updated information in related user data field Field Name: SERVICEPERFORMER Data Element: BAPIUPDATE Data Type: CHAR length (Dec): 1(0) Check table: Conversion Routine: Domain Name: BAPIUPDATE MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /DMBE/SP_BAPIMEOUTITEMX_EXT_MM table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/MERP/MM_MATDOCITEM_ENTITY_STR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/MM_MATDOCITEM_ENTITY_STR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
/SAPWF/MSEG_________________00-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/MSEG_________________00 table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DIMP_ISU_CHARGE_KLASSIFIZIEREN-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIMP_ISU_CHARGE_KLASSIFIZIEREN table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
DIMP_ISU_CHARGE_KLASSIFIZI_CFC-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIMP_ISU_CHARGE_KLASSIFIZI_CFC table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
EAMS_ALM_ORDER_COMPONENT_E_FLE-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_ALM_ORDER_COMPONENT_E_FLE table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCENTRALPURCHASEORDERITEMTP_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASEORDERITEMTP_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCENTRALPURCHASEORDERITEMT_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCENTRALPURCHASEORDERITEMT_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCHASECONTRACTITEMT_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCHASECONTRACTITEMT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISCNTRLPURCHASECONTRACTITEM_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCNTRLPURCHASECONTRACTITEM_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEREQUISITIONITEM_WD_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_WD_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
ISPURCHASEREQUISITIONITEM_W_DR-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPURCHASEREQUISITIONITEM_W_DR table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ACCOUNT_ASSIGNMENT_D-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ACCOUNT_ASSIGNMENT_D table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMIV_SI_S_ACCOUNT_ASSIGNMENT_K-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMIV_SI_S_ACCOUNT_ASSIGNMENT_K table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
MMPUR_S_PRODCOMP_ITEM_ENHANCED-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_PRODCOMP_ITEM_ENHANCED table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATAEKPO_ALL_EKET_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATAEKPO_ALL_EKET_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_DATA_EKP_HASH_EKT_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: * Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_DATA_EKP_HASH_EKT_STY table
|
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 205
Warning: Undefined array key "MEMORYID" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 207
Warning: Undefined array key "APPLCLASS" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 208
Warning: Undefined array key "SHLPNAME" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 209
Warning: Undefined array key "SHLPFIELD" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 210
Warning: Undefined array key "CONVEXIT" in /customers/b/9/9/trailsap.com/httpd.www/sap/index.php on line 211
WRF_POHF_GRIDROW_AC_POSCHE_STY-SERVICEPERFORMER table field - Service Performer
▼
Description: Service Performer Field Name: SERVICEPERFORMER Data Element: SERVICEPERFORMER Data Type: CHAR length (Dec): 10(0) Check table: Conversion Routine: Domain Name: BU_PARTNER MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WRF_POHF_GRIDROW_AC_POSCHE_STY table
|