Details |
VIMPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIMPLA table
|
V_EQUI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EQUI table
|
V_FLEET-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_FLEET table
|
IMPTMMEM-CHANGEDDATETIME table field - Commercial Project Last Changed On
▼
Description: Commercial Project Last Changed On Field Name: CHANGEDDATETIME Data Element: /CPD/CPM_CHANGEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPTMMEM table
|
QAPP_QALS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPP_QALS table
|
VIMPLAPOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIMPLAPOS table
|
CINSPLOTRR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPLOTRR table
|
VIMPLASTAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIMPLASTAT table
|
V_EHAU_TXT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EHAU_TXT table
|
AINSPRESULT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPRESULT table
|
CDOCINFRECD-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCINFRECD table
|
CINSPLOTDOC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPLOTDOC table
|
CQLTYLVLMNG-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYLVLMNG table
|
IMPTEAMRESP-CHANGEDDATETIME table field - Commercial Project Last Changed On
▼
Description: Commercial Project Last Changed On Field Name: CHANGEDDATETIME Data Element: /CPD/CPM_CHANGEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPTEAMRESP table
|
ITENDERING2-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITENDERING2 table
|
PCVORIGINAL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCVORIGINAL table
|
V_EQUI_EQBS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EQUI_EQBS table
|
CINSPCHARDOC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPCHARDOC table
|
CPMNOTIFHEAD-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 14(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPMNOTIFHEAD table
|
CPRCRSRCHITM-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRCRSRCHITM table
|
ESHDOCATTACH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESHDOCATTACH table
|
ICVDOCATTACH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCATTACH table
|
ITORQUANTITY-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITORQUANTITY table
|
PCVDOCATTACH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCVDOCATTACH table
|
VIQMEL_IFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMEL_IFLOS table
|
V_EQUI_IFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EQUI_IFLOS table
|
V_FLEET_EQBS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_FLEET_EQBS table
|
CDOCINFRECOBJ-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDOCINFRECOBJ table
|
CMFGORDDEFREC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEFREC table
|
CMRPCHANGEREQ-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRPCHANGEREQ table
|
EWAV_PJVIQMEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWAV_PJVIQMEL table
|
ICTLGITMMNGTP-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICTLGITMMNGTP table
|
IINSPRESULTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRESULTTP table
|
IINSPSSCHARTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSSCHARTP table
|
IINSPSUBSETTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETTP table
|
IMRPCHANGEREQ-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPCHANGEREQ table
|
IPPSFIDOCOBJL-CHANGEDDATETIME table field - Changed At
▼
Description: Changed At Field Name: CHANGEDDATETIME Data Element: HP_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPSFIDOCOBJL table
|
ITOREXECUTION-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITOREXECUTION table
|
ITORQUANTITY2-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITORQUANTITY2 table
|
V_EHAU_ADDRNR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EHAU_ADDRNR table
|
V_FLEET_IFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_FLEET_IFLOS table
|
AINSPSMPLCHARC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPSMPLCHARC table
|
CCVDOCINFORECD-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CCVDOCINFORECD table
|
CINSPMETHODDOC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPMETHODDOC table
|
CINSPRSLTMLTPL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPRSLTMLTPL table
|
CQLTYCHARCRSLT-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYCHARCRSLT table
|
CTENDERINGCUBE-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTENDERINGCUBE table
|
IINSPRSLTVALTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRSLTVALTP table
|
ITOREXECUTION2-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITOREXECUTION2 table
|
ITOREXECUTIONE-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITOREXECUTIONE table
|
VIAUFKST_IFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIAUFKST_IFLOS table
|
VIQMELST_IFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMELST_IFLOS table
|
CTENDERINGQUERY-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTENDERINGQUERY table
|
ICVDOCCNTNTMGMT-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCCNTNTMGMT table
|
ICVDOCUORIGINAL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCUORIGINAL table
|
IQLTYINPROCMTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINPROCMTTP table
|
AINSPRESULTVALUE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPRESULTVALUE table
|
CDEFECTCHARCRSLT-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTCHARCRSLT table
|
CFRTBKGQUANTITYC-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFRTBKGQUANTITYC table
|
CFRTBKGQUANTITYQ-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFRTBKGQUANTITYQ table
|
CFRTORDQUANTITYC-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFRTORDQUANTITYC table
|
CFRTORDQUANTITYQ-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CFRTORDQUANTITYQ table
|
CINSPSUBCHARCRES-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPSUBCHARCRES table
|
CINSPUSGESGLRSLT-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPUSGESGLRSLT table
|
CQLTCTRLCHARRSLT-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTCTRLCHARRSLT table
|
ICVDOCOBJATTCHDE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCOBJATTCHDE table
|
IINSPSMPLCHARCTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSMPLCHARCTP table
|
IPPMFGOROADOCOBL-CHANGEDDATETIME table field - Changed At
▼
Description: Changed At Field Name: CHANGEDDATETIME Data Element: HP_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGOROADOCOBL table
|
IQINFRCDINPROCUN-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQINFRCDINPROCUN table
|
IQLTYINFORECPROC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINFORECPROC table
|
V_EHAU_ADDRNRTXT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EHAU_ADDRNRTXT table
|
V_EQUI_EQBSIFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EQUI_EQBSIFLOS table
|
V_FLEETEQBSIFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_FLEETEQBSIFLOS table
|
AFIH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIH table
|
CRHH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRHH table
|
EQUI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EQUI table
|
IFLO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLO table
|
IWPK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWPK table
|
MPCR-CHANGEDDATETIME table field - Changed Date and Time
▼
Description: Changed Date and Time Field Name: CHANGEDDATETIME Data Element: CHANGEDDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPCR table
|
MPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPLA table
|
PLKO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLKO table
|
QALS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QALS table
|
QAMR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAMR table
|
QAPP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPP table
|
QASR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QASR table
|
QCPR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCPR table
|
QCVK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCVK table
|
QDQL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDQL table
|
QINF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINF table
|
QMEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMEL table
|
QMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMFE table
|
QMMA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMMA table
|
QMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMSM table
|
QMTB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMTB table
|
QMUR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMUR table
|
QPMK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QPMK table
|
AAFIH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AAFIH table
|
AFIHF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIHF table
|
AFIHW-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AFIHW table
|
IFLOH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLOH table
|
IFLOT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLOT table
|
PLKOB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLKOB table
|
PLKOD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLKOD table
|
PPLKO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPLKO table
|
QAPPD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPPD table
|
QAPPS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPPS table
|
QAPPV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPPV table
|
QAPSR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPSR table
|
QBAAL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QBAAL table
|
QCPRD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCPRD table
|
QCPRP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCPRP table
|
QDQLD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDQLD table
|
QDQLV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDQLV table
|
QMTBV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMTBV table
|
QPMKV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QPMKV table
|
RCRHH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCRHH table
|
VEQUI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VEQUI table
|
VIORD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIORD table
|
VQMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQMFE table
|
VQMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQMSM table
|
WQMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WQMFE table
|
WQMMA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WQMMA table
|
WQMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WQMSM table
|
WQMUR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WQMUR table
|
CAUFVD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAUFVD table
|
DIIFLO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIIFLO table
|
DIMPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIMPLA table
|
DIPLKO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIPLKO table
|
DIQMEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMEL table
|
DIQMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMFE table
|
DIQMMA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMMA table
|
DIQMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMSM table
|
DIQMUR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMUR table
|
IFLOTH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLOTH table
|
IFMEA1-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEA1 table
|
MCPLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCPLOS table
|
MCQALS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQALS table
|
MCQMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMFE table
|
MCQMMA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMMA table
|
MCQMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMSM table
|
MCQMUR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMUR table
|
QALSVB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QALSVB table
|
QALTPP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QALTPP table
|
QCVKEA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCVKEA table
|
RIEQUI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RIEQUI table
|
VBMPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VBMPLA table
|
VIQMEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMEL table
|
VIQMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMFE table
|
VIQMMA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMMA table
|
VIQMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMSM table
|
VIQMUR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMUR table
|
V_EHAU-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EHAU table
|
ADEFECT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ADEFECT table
|
CAUFVDB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAUFVDB table
|
CAUFVDQ-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAUFVDQ table
|
DIIFLOX-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIIFLOX table
|
DIQMELX-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMELX table
|
DIQMMAX-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMMAX table
|
DIQMSMX-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIQMSMX table
|
IDEFECT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECT table
|
IFLO_VS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLO_VS table
|
IRTGHDR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGHDR table
|
MCCAUFV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCCAUFV table
|
MCQALSB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQALSB table
|
MCQMFEB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMFEB table
|
MCQMMAB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMMAB table
|
MCQMSMB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMSMB table
|
MCQMURB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MCQMURB table
|
PLKO_DI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLKO_DI table
|
QDQLSEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDQLSEL table
|
QMFECAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMFECAT table
|
QMMACAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMMACAT table
|
QMSMCAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMSMCAT table
|
QMTBDOC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMTBDOC table
|
QMURCAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMURCAT table
|
QTASK_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QTASK_D table
|
VAFILOA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VAFILOA table
|
VSAFIHB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VSAFIHB table
|
CAPP_TSK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAPP_TSK table
|
CAUFVD_P-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAUFVD_P table
|
CQLTYFAI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYFAI table
|
CREVIEWS-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CREVIEWS table
|
IFLOT_VS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLOT_VS table
|
IFMEATSK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEATSK table
|
IINSPPLV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLV table
|
IQLTYFAI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYFAI table
|
IQLTYLVL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYLVL table
|
IQLTYTSK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSK table
|
MPLA_AS2-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPLA_AS2 table
|
QALTPPSR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QALTPPSR table
|
QEPPUNKT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QEPPUNKT table
|
QINF_FAI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINF_FAI table
|
QMMAPCAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMMAPCAT table
|
QMSMPCAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMSMPCAT table
|
QPS_QPMK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QPS_QPMK table
|
TSK_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSK_DATA table
|
VIAUFKST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIAUFKST table
|
VIQMELST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMELST table
|
VQQMELST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQQMELST table
|
CAUFVDGET-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAUFVDGET table
|
CINSPPLTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CINSPPLTP table
|
IDEFECTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFECTTP table
|
IFLOT_INC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFLOT_INC table
|
IFMEANODE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEANODE table
|
IINSPPLTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPPLTP table
|
IMPMEMBER-CHANGEDDATETIME table field - Commercial Project Last Changed On
▼
Description: Commercial Project Last Changed On Field Name: CHANGEDDATETIME Data Element: /CPD/CPM_CHANGEDON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: DEC15 MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMPMEMBER table
|
INOTIFACT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFACT table
|
INOTIFITM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFITM table
|
INOTIFTSK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFTSK table
|
PLKO_EXIT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLKO_EXIT table
|
QAPPS_D01-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAPPS_D01 table
|
QDEFECT_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QDEFECT_D table
|
QINSPPL_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPPL_D table
|
QLTYLVL_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYLVL_D table
|
QQINF_FAI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QQINF_FAI table
|
REEX_EQUI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REEX_EQUI table
|
VSAFIH_CN-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VSAFIH_CN table
|
CAUFVD_MOR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CAUFVD_MOR table
|
CDEFECTFDP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTFDP table
|
CDEFTSKREC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFTSKREC table
|
CIFMEAELND-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIFMEAELND table
|
CMFGORDDEF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMFGORDDEF table
|
DRAD_DRAFT-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRAD_DRAFT table
|
DRAW_DRAFT-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DRAW_DRAFT table
|
EAM_S_MPCR-CHANGEDDATETIME table field - Changed Date and Time
▼
Description: Changed Date and Time Field Name: CHANGEDDATETIME Data Element: CHANGEDDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_MPCR table
|
FNDEIFQALS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFQALS table
|
FNDEIFQAMR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FNDEIFQAMR table
|
GHO_V_QMEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP GHO_V_QMEL table
|
ICMMROBJHD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMROBJHD table
|
IPRSOLPROC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSOLPROC table
|
IQLTYFAITP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYFAITP table
|
IQLTYLVLTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYLVLTP table
|
IQLTYTSKTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYTSKTP table
|
IQNOTIFACT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFACT table
|
IQNOTIFTSK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQNOTIFTSK table
|
ITRANSPLOC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPLOC table
|
MPLAN_MPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPLAN_MPLA table
|
MQC_CAUFVD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MQC_CAUFVD table
|
PLMM_AUDIT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMM_AUDIT table
|
PMARC_AFIH-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMARC_AFIH table
|
QINSMETH_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSMETH_D table
|
QINSPLOT_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPLOT_D table
|
QINSSPEC_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSSPEC_D table
|
AINSPCHARAC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPCHARAC table
|
AINSPSUBSET-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPSUBSET table
|
CDEFECTTFDP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CDEFECTTFDP table
|
CXMO_CAUFVD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CXMO_CAUFVD table
|
EAM_S_PLKOD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_PLKOD table
|
EWAV_PJIMRG-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWAV_PJIMRG table
|
IFMEAEFFECT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IFMEAEFFECT table
|
IINSPRESULT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPRESULT table
|
IINSPSUBSET-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSET table
|
INOTIFCAUSE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INOTIFCAUSE table
|
IQLTYCERTPF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYCERTPF table
|
IQLTYNTFCAU-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFCAU table
|
IQLTYNTFITM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITM table
|
ISDEFECT_TP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP table
|
IWOS_CAUFVD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWOS_CAUFVD table
|
PHIN_S_MPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PHIN_S_MPLA table
|
REEX_EQUI_X-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REEX_EQUI_X table
|
VIAUFK_AFVC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIAUFK_AFVC table
|
VQAMR_ACTIV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQAMR_ACTIV table
|
VQASR_ACTIV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQASR_ACTIV table
|
/ISDFPS/EQUI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/EQUI table
|
/ISDFPS/MPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/MPLA table
|
COCOLORD_INF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCOLORD_INF table
|
CPVPOSTEDAIQ-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPVPOSTEDAIQ table
|
CQLTYTSKPROC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYTSKPROC table
|
EAMI_DEV_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_OUT table
|
ICITITEMCLFN-CHANGEDDATETIME table field - Last Changed Date Time
▼
Description: Last Changed Date Time Field Name: CHANGEDDATETIME Data Element: LAST_CHANGED_DATE_TIME Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICITITEMCLFN table
|
ICMMROBECTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICMMROBECTTP table
|
IHSBKCTRYTTG-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IHSBKCTRYTTG table
|
IINSPCHARCTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPCHARCTP table
|
IJPTAXOFFSET-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJPTAXOFFSET table
|
IJPTAXREALOC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJPTAXREALOC table
|
IMSTRRECPHDR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMSTRRECPHDR table
|
IOPNCTLGITEM-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IOPNCTLGITEM table
|
IPRSOLPROCTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPRSOLPROCTP table
|
IPVTAXRPTGLA-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVTAXRPTGLA table
|
ITRANSPORDER-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPORDER table
|
PCITITEMCLFN-CHANGEDDATETIME table field - Last Changed Date Time
▼
Description: Last Changed Date Time Field Name: CHANGEDDATETIME Data Element: LAST_CHANGED_DATE_TIME Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCITITEMCLFN table
|
QCERT_TS_LOT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCERT_TS_LOT table
|
RCJ_PS_ORDER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCJ_PS_ORDER table
|
VQAPP_ACTIVE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VQAPP_ACTIVE table
|
V_DEF_BO2ACT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_DEF_BO2ACT table
|
/ISDFPS/WQMFE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/WQMFE table
|
/ISDFPS/WQMMA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/WQMMA table
|
/ISDFPS/WQMSM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/WQMSM table
|
/ISDFPS/WQMUR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/WQMUR table
|
AUDPLMM_AUDIT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUDPLMM_AUDIT table
|
CMPESFODEFECT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMPESFODEFECT table
|
CMRPCHREQLINE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMRPCHREQLINE table
|
CQNOTIFTSKFDP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQNOTIFTSKFDP table
|
CTLGITM_DRAFT-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTLGITM_DRAFT table
|
CXMO_CAUFVD_O-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CXMO_CAUFVD_O table
|
EAM_CL_QALS_V-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_CL_QALS_V table
|
FDP_QM_DEFECT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT table
|
ICVDOCINFOREC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCINFOREC table
|
ICVDOCOBJLINK-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCOBJLINK table
|
IDIRHDRWODRTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDIRHDRWODRTP table
|
IINSPSPECVERS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSPECVERS table
|
IMFGDEFECTSIT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGDEFECTSIT table
|
IMFGORDDEFREC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGORDDEFREC table
|
IMRPCHREQLINE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPCHREQLINE table
|
IPVTXRPTGHCOC-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVTXRPTGHCOC table
|
IPVTXRPTGHCOS-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVTXRPTGHCOS table
|
IQLTYINPROCMT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYINPROCMT table
|
IQLTYNTFITMTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYNTFITMTP table
|
ISDEFECT_TP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_D table
|
ITRANSPORDANA-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPORDANA table
|
ITRANSPORDERE-CHANGEDDATETIME table field - Created on Timestamp
▼
Description: Created on Timestamp Field Name: CHANGEDDATETIME Data Element: LOG_CREATED_ON Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPORDERE table
|
MPD_MPLA_STRC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPD_MPLA_STRC table
|
PCVDOCINFOREC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCVDOCINFOREC table
|
PCVDOCOBJLINK-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCVDOCOBJLINK table
|
PMFGORDDEFREC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGORDDEFREC table
|
PMRPCHANGEREQ-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMRPCHANGEREQ table
|
PNTFIAOACTPAR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PNTFIAOACTPAR table
|
QCERT_TS_CERT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCERT_TS_CERT table
|
QPROBSOLVPROC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QPROBSOLVPROC table
|
RCJ_PS_PM_OBJ-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RCJ_PS_PM_OBJ table
|
V_QTSK_DR2ACT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_QTSK_DR2ACT table
|
/ISDFPS/VIQMEL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/VIQMEL table
|
AINSPECTIONLOT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPECTIONLOT table
|
AINSPSAMPLERES-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPSAMPLERES table
|
COCF_S_QM_LIST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCF_S_QM_LIST table
|
COCF_S_SN_LIST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCF_S_SN_LIST table
|
CPRSOLPROCEXCT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPRSOLPROCEXCT table
|
CPVTAXRPTGHCOC-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPVTAXRPTGHCOC table
|
CPVTAXRPTGHCOS-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPVTAXRPTGHCOS table
|
CQLTYNTFITMFDP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYNTFITMFDP table
|
EAMS_S_SP_MPCR-CHANGEDDATETIME table field - Changed Date and Time
▼
Description: Changed Date and Time Field Name: CHANGEDDATETIME Data Element: CHANGEDDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_SP_MPCR table
|
EXEC_TASKLISTS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EXEC_TASKLISTS table
|
ICVDOCINFORECD-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCINFORECD table
|
IDEFAOLASTTASK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDEFAOLASTTASK table
|
IDIRDESCWODRTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDIRDESCWODRTP table
|
IINSPECTIONLOT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPECTIONLOT table
|
IINSPOPDPCHARC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPOPDPCHARC table
|
IINSPSUBSETTP2-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETTP2 table
|
ILOCATIONBASIC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ILOCATIONBASIC table
|
IMRPCREQLBASIC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPCREQLBASIC table
|
IPVACCTGDOCDTL-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVACCTGDOCDTL table
|
IPVACCTGDOCHDR-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPVACCTGDOCHDR table
|
IQLTYDFCTUNION-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IQLTYDFCTUNION table
|
IRESOURCEBASIC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: /SAPAPO/CRES_TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRESOURCEBASIC table
|
IRTGHDRSRCHMOD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRTGHDRSRCHMOD table
|
ISDEFECT_TP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_DR table
|
ISINSPPLANEDIT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPPLANEDIT table
|
ISUWA_EQUI_SUB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUWA_EQUI_SUB table
|
PCVDOCINFORECD-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PCVDOCINFORECD table
|
PLMM_AUDIT_ACT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMM_AUDIT_ACT table
|
PLMM_QUEST_RES-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMM_QUEST_RES table
|
PLMT_TS_FMEA_C-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_TS_FMEA_C table
|
PLMT_TS_FMEA_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_TS_FMEA_D table
|
PMFGDEFECTHIST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PMFGDEFECTHIST table
|
QLTYINPRCFAI_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYINPRCFAI_D table
|
QLTYINPROCMT_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QLTYINPROCMT_D table
|
QMS_MAP_FMEATP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMS_MAP_FMEATP table
|
REBD_EQUIPMENT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBD_EQUIPMENT table
|
TSK_CLASS_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP TSK_CLASS_DATA table
|
VIQMEL_RIQS0_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIQMEL_RIQS0_S table
|
/SYCLO/VIAFVC_V-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/VIAFVC_V table
|
AINSPLOTUSGDCSN-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AINSPLOTUSGDCSN table
|
CIFRESTMPMORDER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CIFRESTMPMORDER table
|
CMM_ROBJ_HEADER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_ROBJ_HEADER table
|
CPVACCTGDOCHDRQ-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPVACCTGDOCHDRQ table
|
CQLTYLVLBYSVRTY-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CQLTYLVLBYSVRTY table
|
CRHH_ADMIN_INFO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CRHH_ADMIN_INFO table
|
EAM_S_MPCR_MPOS-CHANGEDDATETIME table field - Changed Date and Time
▼
Description: Changed Date and Time Field Name: CHANGEDDATETIME Data Element: CHANGEDDATETIME Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_MPCR_MPOS table
|
EAM_S_PLKOD_EXT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_PLKOD_EXT table
|
ICVDOCINFORECTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCINFORECTP table
|
ICVDOCOBJLINKTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCOBJLINKTP table
|
IINSPMETHODVERS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPMETHODVERS table
|
IINSPMETHVERSTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPMETHVERSTP table
|
IINSPSPECVERSTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSPECVERSTP table
|
IINSPSUBSETRSLT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSUBSETRSLT table
|
IMRPREQUESTNOTE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMRPREQUESTNOTE table
|
INTFIAFFCDOBJLT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP INTFIAFFCDOBJLT table
|
IPPBILLOFOPERCS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPBILLOFOPERCS table
|
IRUIMPRTNOTIFIB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRUIMPRTNOTIFIB table
|
ISQUALITYTASKTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP table
|
ISUWA_EQUI_AUTO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUWA_EQUI_AUTO table
|
ISUWA_EQUI_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUWA_EQUI_DATA table
|
ISUWA_EQUI_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUWA_EQUI_DATA table
|
ITORROOTANAMNTR-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITORROOTANAMNTR table
|
PDEFAOACTNPARAM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDEFAOACTNPARAM table
|
PDOCINFORECCALC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PDOCINFORECCALC table
|
PRUIMPNOTIFHDRG-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUIMPNOTIFHDRG table
|
QINSPSUBSETRR_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QINSPSUBSETRR_D table
|
QPROBSOLVPROC_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QPROBSOLVPROC_D table
|
SEPM_IIMGDDRAFT-CHANGEDDATETIME table field - UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun)
▼
Description: UTC Time Stamp in Long Form (YYYYMMDDhhmmssmmmuuun) Field Name: CHANGEDDATETIME Data Element: TIMESTAMPL Data Type: DEC length (Dec): 21(7) Check table: Conversion Routine: Domain Name: TZNTSTMPL MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP SEPM_IIMGDDRAFT table
|
V_EQUI_EQBS_SML-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EQUI_EQBS_SML table
|
/SCMTMS/CV_RES01-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: /SAPAPO/CRES_TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SCMTMS/CV_RES01 table
|
/SMERP/STG_PM002-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/STG_PM002 table
|
/SMERP/STG_PM008-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/STG_PM008 table
|
/SMERP/STG_PM014-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/STG_PM014 table
|
CPVTAXRPTGHISTLA-CHANGEDDATETIME table field - Changed On Timestamp
▼
Description: Changed On Timestamp Field Name: CHANGEDDATETIME Data Element: OIU_VDM_CHANGED_ON_TS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CPVTAXRPTGHISTLA table
|
CTRANSPORDITMDEX-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CTRANSPORDITMDEX table
|
EAMI_DEV_CHG_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_CHG_OUT table
|
EAMI_DEV_CHG_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_CHG_OUT table
|
EAM_RCPNTLOCPLNT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_RCPNTLOCPLNT table
|
EAM_RCPNTLOC_COD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_RCPNTLOC_COD table
|
EMG_CONTGRP_AUTO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EMG_CONTGRP_AUTO table
|
ESH_L_DOCINFOREC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_L_DOCINFOREC table
|
ESH_U_DOCINFOREC-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ESH_U_DOCINFOREC table
|
ICVDOCINFRCSRCHM-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCINFRCSRCHM table
|
ICVDOCOBJECTLINK-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ICVDOCOBJECTLINK table
|
IDIROBJPRDWODRTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IDIROBJPRDWODRTP table
|
IINSPECTIONLOTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPECTIONLOTTP table
|
IINSPSAMPLERESTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IINSPSAMPLERESTP table
|
IJPTAXALLCRESULT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IJPTAXALLCRESULT table
|
IMAINTORDINSPLOT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMAINTORDINSPLOT table
|
IMFGBILLOFOPERCS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IMFGBILLOFOPERCS table
|
IPPMFGORDDOCOBJL-CHANGEDDATETIME table field - Changed At
▼
Description: Changed At Field Name: CHANGEDDATETIME Data Element: HP_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORDDOCOBJL table
|
IPPMFGORERDOCORI-CHANGEDDATETIME table field - Changed At
▼
Description: Changed At Field Name: CHANGEDDATETIME Data Element: HP_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGORERDOCORI table
|
IPPMFGOROPDOCOBL-CHANGEDDATETIME table field - Changed At
▼
Description: Changed At Field Name: CHANGEDDATETIME Data Element: HP_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGOROPDOCOBL table
|
IPPMFGOROPDOCORI-CHANGEDDATETIME table field - Changed At
▼
Description: Changed At Field Name: CHANGEDDATETIME Data Element: HP_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IPPMFGOROPDOCORI table
|
IRUIMPRTNOTIFCMB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRUIMPRTNOTIFCMB table
|
IRUIMPRTNOTIFHDB-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IRUIMPRTNOTIFHDB table
|
ISQUALITYLEVELTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYLEVELTP table
|
ISUWA_PROP_LINES-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUWA_PROP_LINES table
|
ITORSTPLSTREPEVT-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITORSTPLSTREPEVT table
|
ITRANSPORDANAIEP-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPORDANAIEP table
|
ITRANSPORDEXEANA-CHANGEDDATETIME table field - Changed On
▼
Description: Changed On Field Name: CHANGEDDATETIME Data Element: /SCMTMS/VDM_TM_TSTMP_CHT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ITRANSPORDEXEANA table
|
J_3RS_IMNT_CMT_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP J_3RS_IMNT_CMT_D table
|
J_3RS_IMNT_HDR_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP J_3RS_IMNT_HDR_D table
|
J_3RS_IMNT_ITM_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP J_3RS_IMNT_ITM_D table
|
MPES_EXEC_DEFECT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_EXEC_DEFECT table
|
PLMM_AUDIT_ACTCD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMM_AUDIT_ACTCD table
|
PLMM_QUEST_RESCD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMM_QUEST_RESCD table
|
PLMT_TS_FMEA_XML-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_TS_FMEA_XML table
|
PPPMFGORDDOCOBJL-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PPPMFGORDDOCOBJL table
|
PRUIMPNOTIFHDRBP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUIMPNOTIFHDRBP table
|
PRUIMPRTNOTIFCMT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUIMPRTNOTIFCMT table
|
PRUIMPRTNOTIFHDR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUIMPRTNOTIFHDR table
|
PRUIMPRTNOTIFIT2-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUIMPRTNOTIFIT2 table
|
PRUIMPRTNOTIFITM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TIMESTAMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PRUIMPRTNOTIFITM table
|
PSHLP_CAUFVBT_ST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSHLP_CAUFVBT_ST table
|
QCERT_TS_LOT_PDF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCERT_TS_LOT_PDF table
|
QSNOTIF_ITEM_ALV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QSNOTIF_ITEM_ALV table
|
QSUBSETCHARCRR_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QSUBSETCHARCRR_D table
|
REBD_EQUIPMENT_X-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP REBD_EQUIPMENT_X table
|
VIAUFK_AFVCIFLOS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP VIAUFK_AFVCIFLOS table
|
V_EAM_RCPTLCPLNT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EAM_RCPTLCPLNT table
|
V_EAM_RCPTLC_COD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_EAM_RCPTLC_COD table
|
V_PROBSOLVPR_B2A-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP V_PROBSOLVPR_B2A table
|
AUDPLMM_AUDIT_ACT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUDPLMM_AUDIT_ACT table
|
AUDPLMM_QUEST_RES-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUDPLMM_QUEST_RES table
|
CMM_S_ROBJ_BASE_H-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_BASE_H table
|
DIACL_DLE_WQMFE_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIACL_DLE_WQMFE_S table
|
DIACL_DLE_WQMMA_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP DIACL_DLE_WQMMA_S table
|
EAMI_DEV_DATA_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_DATA_OUT table
|
ISCMMDTYRISKOBJTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYRISKOBJTP table
|
ISINSPECTIONLOTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONLOTTP table
|
ISQUALITYTASKTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_D table
|
ISUMI_DEVICE_AUTO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUMI_DEVICE_AUTO table
|
MMPUR_S_UI_REVIEW-CHANGEDDATETIME table field - Time Stamp (In UTC)
▼
Description: Time Stamp (In UTC) Field Name: CHANGEDDATETIME Data Element: BCOS_TSTMP Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: BCOS_TSTMP MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MMPUR_S_UI_REVIEW table
|
PLMT_AUDIT_ACTION-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_AUDIT_ACTION table
|
PLMT_AUDIT_ACT_UI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_AUDIT_ACT_UI table
|
PLMT_QUEST_RESULT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_QUEST_RESULT table
|
QCERT_TS_QCVK_MIG-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QCERT_TS_QCVK_MIG table
|
/ISDFPS/TLUPS_PLKO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/TLUPS_PLKO table
|
/SYCLO/PM_EQUI_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_EQUI_STR table
|
/SYCLO/PM_QMEL_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_QMEL_STR table
|
/SYCLO/PM_QMFE_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_QMFE_STR table
|
/SYCLO/PM_QMMA_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_QMMA_STR table
|
/SYCLO/PM_QMSM_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_QMSM_STR table
|
/SYCLO/PM_QMUR_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_QMUR_STR table
|
EMG_CONTAINER_AUTO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EMG_CONTAINER_AUTO table
|
EWASCONTAINER_INFO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWASCONTAINER_INFO table
|
ISCATALOGITEMMNGTP-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCATALOGITEMMNGTP table
|
ISINSPECTIONPLANTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP table
|
ISQUALITYLEVELTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYLEVELTP_D table
|
ISQUALITYTASKTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_DR table
|
PLMT_AUDIT_ACT_ALV-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_AUDIT_ACT_ALV table
|
PLMT_AUDIT_ACT_PRI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_AUDIT_ACT_PRI table
|
PSHLP_TREX_AFIH_ST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PSHLP_TREX_AFIH_ST table
|
QMS_MAP_FMEANODETP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QMS_MAP_FMEANODETP table
|
RPLM_TS_DEFECT_DIS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_DEFECT_DIS table
|
RPLM_TS_DEFECT_DIS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_DEFECT_DIS table
|
RPLM_TS_DEFECT_DIS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_DEFECT_DIS table
|
RPLM_TS_NOTIF_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_NOTIF_DATA table
|
/PLMI/S_MRCP_HEADER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/S_MRCP_HEADER table
|
/SYCLO/PM_FLEET_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_FLEET_STR table
|
/SYCLO/PM_IFLOT_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_IFLOT_STR table
|
AUDPLMM_AUDIT_ACTCD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUDPLMM_AUDIT_ACTCD table
|
AUDPLMM_QUEST_RESCD-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP AUDPLMM_QUEST_RESCD table
|
COCF_S_SN_LIST_FLAT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COCF_S_SN_LIST_FLAT table
|
COMES_S_DRF_ROUTING-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP COMES_S_DRF_ROUTING table
|
EAMI_DEV_CHG_RQ_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_CHG_RQ_OUT table
|
EAMI_DEV_CHG_RQ_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_CHG_RQ_OUT table
|
EAMI_DEV_CRT_RQ_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_CRT_RQ_OUT table
|
EAMS_S_BO_TL_HEADER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_BO_TL_HEADER table
|
FDP_QM_DEFECT_TASKS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FDP_QM_DEFECT_TASKS table
|
ISCMMDTYRISKOBJTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCMMDTYRISKOBJTP_D table
|
ISINSPECTIONLOTTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONLOTTP_D table
|
ISINSPSAMPLECHARCTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSAMPLECHARCTP table
|
ISPROBSOLVINGPROCTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPROBSOLVINGPROCTP table
|
ISQUALITYLEVELTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYLEVELTP_DR table
|
IWOS_COMPLETE_ORDER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWOS_COMPLETE_ORDER table
|
IWOS_COMPLETE_ORDER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP IWOS_COMPLETE_ORDER table
|
OPS_RQGAAM31_QALS_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQGAAM31_QALS_S table
|
OPS_RQGAAM31_QAPP_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQGAAM31_QAPP_S table
|
/PLMI/S_MRCP_DETAILS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /PLMI/S_MRCP_DETAILS table
|
ISCATALOGITEMMNGTP_D-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCATALOGITEMMNGTP_D table
|
ISINSPECTIONLOTTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONLOTTP_DR table
|
ISINSPECTIONPLANTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP_D table
|
ISINSPECTIONRESULTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTTP table
|
ISINSPECTIONSUBSETTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP table
|
ISINSPSAMPLERESULTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSAMPLERESULTTP table
|
OPS_RQEEAS20_STR_PDF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQEEAS20_STR_PDF table
|
/ISDFPS/FDP_EQUI_EQBS-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/FDP_EQUI_EQBS table
|
/ISDFPS/PM_MBOOK_MPLA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/PM_MBOOK_MPLA table
|
/SYCLOU/MD_DEVICE_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLOU/MD_DEVICE_STR table
|
CMM_S_ROBJ_ADMIN_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_ADMIN_DATA table
|
EAMI_DEV_DATA_CHG_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_DATA_CHG_OUT table
|
EAMI_DEV_DATA_CHG_OUT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMI_DEV_DATA_CHG_OUT table
|
EAM_S_IFLO_HIER_STRUC-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_S_IFLO_HIER_STRUC table
|
HASH_DATA_FOR_SRVCREQ-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HASH_DATA_FOR_SRVCREQ table
|
ISCATALOGITEMMNGTP_DR-CHANGEDDATETIME table field -
▼
Description: Field Name: CHANGEDDATETIME Data Element: Data Type: CHAR length (Dec): 30(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISCATALOGITEMMNGTP_DR table
|
ISINSPECTIONPLANTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONPLANTP_DR table
|
ISINSPECTIONSUBSETTP2-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP2 table
|
ISINSPSAMPLECHARCTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSAMPLECHARCTP_D table
|
ISPROBSOLVINGPROCTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPROBSOLVINGPROCTP_D table
|
ISUMI_CONNECTION_AUTO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISUMI_CONNECTION_AUTO table
|
ODATA_CV_S_ATTACHMENT-CHANGEDDATETIME table field - Time of change (UTC)
▼
Description: Time of change (UTC) Field Name: CHANGEDDATETIME Data Element: SDOK_CHTST Data Type: NUMC length (Dec): 14(0) Check table: Conversion Routine: Domain Name: SDOK_TSTMP MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ODATA_CV_S_ATTACHMENT table
|
OPS_RQGAAM31_QALTPP_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQGAAM31_QALTPP_S table
|
PLMT_AUDIT_AUO_DB_WRK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_AUDIT_AUO_DB_WRK table
|
PLMT_EVALUATION_QUEST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_EVALUATION_QUEST table
|
PLMT_QUEST_RES_DB_WRK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_QUEST_RES_DB_WRK table
|
RPLM_TS_NOTIF_ITEM_UI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_NOTIF_ITEM_UI table
|
RPLM_TS_NOTIF_TASK_UI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_NOTIF_TASK_UI table
|
/ISDFPS/PM_MBOOK_MPLAN-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/PM_MBOOK_MPLAN table
|
/ISDFPS/PM_MBOOK_ORDER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/PM_MBOOK_ORDER table
|
/SMERP/PM_LAM_EQUI_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_LAM_EQUI_STR table
|
/SYCLO/DSD_VEHICLE_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/DSD_VEHICLE_STR table
|
EAMS_S_BO_MPLAN_HEADER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_BO_MPLAN_HEADER table
|
EAMS_S_SP_MPLAN_HEADER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_SP_MPLAN_HEADER table
|
EAM_WF_MPLAN_DETAILS_S-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAM_WF_MPLAN_DETAILS_S table
|
HASH_DATA_FOR_MAINTPLN-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP HASH_DATA_FOR_MAINTPLN table
|
ISDOCUMENTINFORECORDTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDTP table
|
ISINSPCHARACTERISTICTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPCHARACTERISTICTP table
|
ISINSPECTIONRESULTTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTTP_D table
|
ISINSPECTIONSUBSETTP_2-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_2 table
|
ISINSPECTIONSUBSETTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_D table
|
ISINSPSAMPLERESULTTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSAMPLERESULTTP_D table
|
ISPROBSOLVINGPROCTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISPROBSOLVINGPROCTP_DR table
|
OPS_RQEEAS20_TSTR2_PDF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQEEAS20_TSTR2_PDF table
|
OPS_RQQMRB01_WQMFE_PDF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQQMRB01_WQMFE_PDF table
|
QAN_QM_INSP_METHOD_PDF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QAN_QM_INSP_METHOD_PDF table
|
QBEXT_TS_QINF_ENHANCED-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP QBEXT_TS_QINF_ENHANCED table
|
RPLM_TS_NOTIF_CAUSE_UI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_NOTIF_CAUSE_UI table
|
WTYSC_WWB_NAVTREE_DATA-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP WTYSC_WWB_NAVTREE_DATA table
|
/ISDFPS/PM_MBOOK_FLIGHT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/PM_MBOOK_FLIGHT table
|
/SMERP/PM_EQUI_LSET_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_EQUI_LSET_STR table
|
/SMERP/PM_FLOC_LSET_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_FLOC_LSET_STR table
|
/SMERP/PM_LAM_IFLOT_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_LAM_IFLOT_STR table
|
/STTPEC/S_TRN_WO_HEADER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /STTPEC/S_TRN_WO_HEADER table
|
/SYCLO/PM_EQUI_HIER_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/PM_EQUI_HIER_STR table
|
EAMS_S_SP_MPLAN_INITIAL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_SP_MPLAN_INITIAL table
|
ISINSPECTIONSUBSETTP2_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP2_D table
|
ISINSPECTIONSUBSETTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_DR table
|
RPLM_TS_NOTIF_HEADER_UI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_NOTIF_HEADER_UI table
|
RPLM_TS_POWL_INSP_POINT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_POWL_INSP_POINT table
|
/ISDFPS/LM_ACCIDENT_CONF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/LM_ACCIDENT_CONF table
|
/ISDFPS/PM_MBOOK_CONFIRM-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/PM_MBOOK_CONFIRM table
|
/SMERP/PM_IFLOT_INCL_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_IFLOT_INCL_STR table
|
/SMISU/MD_CONNECTION_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMISU/MD_CONNECTION_STR table
|
CMM_S_ROBJ_BASE_COMPLETE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_ROBJ_BASE_COMPLETE table
|
ISDOCUMENTINFORECORDTP_D-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDTP_D table
|
ISINSPECTIONSUBSETTP_2_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONSUBSETTP_2_D table
|
ISQLTYFIRSTARTICLEINSPTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQLTYFIRSTARTICLEINSPTP table
|
ISQUALITYINPROCUREMENTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP table
|
PLMT_AUDIT_ACTION_DB_WRK-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP PLMT_AUDIT_ACTION_DB_WRK table
|
/ISDFPS/LM_ACCIDENT_ORDER-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/LM_ACCIDENT_ORDER table
|
/MERP/PM_EQUIP_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_EQUIP_ENTITY_STR table
|
/SMISU/BTX_EQUI_EGERH_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMISU/BTX_EQUI_EGERH_STR table
|
CMM_S_CD_RO_BASE_COMPLETE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP CMM_S_CD_RO_BASE_COMPLETE table
|
FINS_CFIN_CO_AIF_ORD_STRU-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_CO_AIF_ORD_STRU table
|
FINS_CFIN_CO_AIF_ORD_TYPE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_CO_AIF_ORD_TYPE table
|
ISDOCUMENTINFORECORDTP1_D-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDTP1_D table
|
ISDOCUMENTINFORECORDTP_DR-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDTP_DR table
|
ISINSPCHARACTERISTICTP1_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPCHARACTERISTICTP1_D table
|
ISINSPECTIONRESULTVALUETP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTVALUETP table
|
ISINSPSUBSETCHARCRESULTTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSUBSETCHARCRESULTTP table
|
ODATA_CV_S_HDM_ATTACHMENT-CHANGEDDATETIME table field - Time of change (UTC)
▼
Description: Time of change (UTC) Field Name: CHANGEDDATETIME Data Element: SDOK_CHTST Data Type: NUMC length (Dec): 14(0) Check table: Conversion Routine: Domain Name: SDOK_TSTMP MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ODATA_CV_S_HDM_ATTACHMENT table
|
RPLM_TS_NOTIF_ACTIVITY_UI-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_NOTIF_ACTIVITY_UI table
|
/ISDFPS/LM_ACCIDENT_FLIGHT-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /ISDFPS/LM_ACCIDENT_FLIGHT table
|
/SYCLO/CS_NOTIF_HEADER_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/CS_NOTIF_HEADER_STR table
|
/SYCLO/MM_MATSERIALNUM_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SYCLO/MM_MATSERIALNUM_STR table
|
ISDOCUMENTINFORECORDTP1_DR-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDTP1_DR table
|
ISQLTYFIRSTARTICLEINSPTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQLTYFIRSTARTICLEINSPTP_D table
|
ISQUALITYINPROCUREMENTTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP_D table
|
RPLM_TS_POWL_TASK_GEN_INFO-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP RPLM_TS_POWL_TASK_GEN_INFO table
|
/MERP/PM_FUNCLOC_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_FUNCLOC_ENTITY_STR table
|
/SMERP/PM_FLOC_LSET_ESF_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_FLOC_LSET_ESF_STR table
|
/SMERP/PM_LAM_EQUI_LSET_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_LAM_EQUI_LSET_STR table
|
/SMERP/PM_LAM_FLAG_EQUI_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_LAM_FLAG_EQUI_STR table
|
/SMERP/PM_LAM_FLOC_LSET_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SMERP/PM_LAM_FLOC_LSET_STR table
|
EWAEL_PLANTJOUR_VIQMEL_LIST-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EWAEL_PLANTJOUR_VIQMEL_LIST table
|
ISINSPECTIONMETHODVERSIONTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONMETHODVERSIONTP table
|
ISINSPECTIONRESULTVALUETP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONRESULTVALUETP_D table
|
ISINSPSUBSETCHARCRESULTTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSUBSETCHARCRESULTTP_D table
|
ISQLTYFIRSTARTICLEINSPTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQLTYFIRSTARTICLEINSPTP_DR table
|
ISQUALITYINPROCUREMENTTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYINPROCUREMENTTP_DR table
|
OPS_RQPMKV10_OBJECT_TAB_PDF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP OPS_RQPMKV10_OBJECT_TAB_PDF table
|
/MERP/PM_INSPHIST_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_INSPHIST_ENTITY_STR table
|
/MERP/PM_INSP_LOT_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_INSP_LOT_ENTITY_STR table
|
EAMS_S_BO_TL_HEADER_WITH_REF-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP EAMS_S_BO_TL_HEADER_WITH_REF table
|
ISDEFECT_TP_Q_SEL_BY_ROOT_EL-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDEFECT_TP_Q_SEL_BY_ROOT_EL table
|
ISINSPSPECIFICATIONVERSIONTP-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSPECIFICATIONVERSIONTP table
|
ISINSPSUBSETCHARCRESULTTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSUBSETCHARCRESULTTP_DR table
|
MPES_CIMA_PMI_QUICKVIEW_INFO-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP MPES_CIMA_PMI_QUICKVIEW_INFO table
|
ODATA_CV_DOCUMENTHEADERDRAFT-CHANGEDDATETIME table field - Time of change (UTC)
▼
Description: Time of change (UTC) Field Name: CHANGEDDATETIME Data Element: SDOK_CHTST Data Type: NUMC length (Dec): 14(0) Check table: Conversion Routine: Domain Name: SDOK_TSTMP MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ODATA_CV_DOCUMENTHEADERDRAFT table
|
/MERP/PM_EQUIP_SER_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_EQUIP_SER_ENTITY_STR table
|
/MERP/PM_NOTIF_HDR_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_NOTIF_HDR_ENTITY_STR table
|
ISDOCUMENTINFORECORDOBJLINKTP-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDOBJLINKTP table
|
ISINSPECTIONMETHODVERSIONTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONMETHODVERSIONTP_D table
|
ISQUALITYTASKTP_A_EDIT_ACTIVE-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISQUALITYTASKTP_A_EDIT_ACTIVE table
|
/MERP/PM_INSPMETHOD_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_INSPMETHOD_ENTITY_STR table
|
/MERP/PM_INSP_POINT_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_INSP_POINT_ENTITY_STR table
|
/MERP/PM_MSINSPCHAR_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_MSINSPCHAR_ENTITY_STR table
|
/MERP/PM_NOTIF_ACTV_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_NOTIF_ACTV_ENTITY_STR table
|
/MERP/PM_NOTIF_CAUS_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_NOTIF_CAUS_ENTITY_STR table
|
/MERP/PM_NOTIF_ITEM_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_NOTIF_ITEM_ENTITY_STR table
|
/MERP/PM_NOTIF_TASK_ENTITY_STR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /MERP/PM_NOTIF_TASK_ENTITY_STR table
|
/SAPWF/ISQUALITYTASKTP______00-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP /SAPWF/ISQUALITYTASKTP______00 table
|
FINS_CFIN_CO_AIF_ORD_STRU_SIMU-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_CO_AIF_ORD_STRU_SIMU table
|
FINS_CFIN_CO_AIF_ORD_TYPE_SIMU-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP FINS_CFIN_CO_AIF_ORD_TYPE_SIMU table
|
ISDOCUMENTINFORECORDOBJLINKT_D-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDOBJLINKT_D table
|
ISDOCUMENTINFORECORDOBJLINK_DR-CHANGEDDATETIME table field - Time last change was made
▼
Description: Time last change was made Field Name: CHANGEDDATETIME Data Element: DMS_CHANGED_AT Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISDOCUMENTINFORECORDOBJLINK_DR table
|
ISINSPECTIONMETHODVERSIONTP_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPECTIONMETHODVERSIONTP_DR table
|
ISINSPSPECIFICATIONVERSIONTP_D-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSPECIFICATIONVERSIONTP_D table
|
ISINSPSPECIFICATIONVERSIONT_DR-CHANGEDDATETIME table field - UTC Time Stamp in Short Form (YYYYMMDDhhmmss)
▼
Description: UTC Time Stamp in Short Form (YYYYMMDDhhmmss) Field Name: CHANGEDDATETIME Data Element: TZNTSTMPS Data Type: DEC length (Dec): 15(0) Check table: Conversion Routine: Domain Name: TZNTSTMPS MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See details of SAP ISINSPSPECIFICATIONVERSIONT_DR table
|