SAP ITRSYVARPL table - Generated Table for View details in SAP
SAP ITRSYVARPL table summary
Object Name: ITRSYVARPL
Dictionary Type: Table view
Description: Generated Table for View
Field list for ITRSYVARPL table on an S/4 SAP system
Details |
ITRSYVARPL-MANDT table field - Client
▼
Description: Client Field Name: MANDT Data Element: MANDT Data Type: CLNT length (Dec): 3(0) Check table: T000 Conversion Routine: Domain Name: MANDT MemoryID: AppClass: SAP SHLP: SHLP Field: ConvExit: See all SAP tables containing field MANDT
|
ITRSYVARPL-VALIDITYDATE table field - Key Date in Results Databases
▼
Description: Key Date in Results Databases Field Name: VALIDITYDATE Data Element: RDB_KEYDATE Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALIDITYDATE
|
ITRSYVARPL-MARKETRISKHIERARCHYNODE table field - Node of Risk Hierarchy
▼
Description: Node of Risk Hierarchy Field Name: MARKETRISKHIERARCHYNODE Data Element: RDBRA_RKNOTEN Data Type: NUMC length (Dec): 6(0) Check table: Conversion Routine: Domain Name: JBRRHKNID MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETRISKHIERARCHYNODE
|
ITRSYVARPL-VALUEATRISKSIMULATIONRUN table field - Simulation Index (Block Index)
▼
Description: Simulation Index (Block Index) Field Name: VALUEATRISKSIMULATIONRUN Data Element: RDBRA_SIMIDX Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUEATRISKSIMULATIONRUN
|
ITRSYVARPL-TREASURYFINANCIALOBJECT table field - Object Number for Financial Transactions
▼
Description: Object Number for Financial Transactions Field Name: TREASURYFINANCIALOBJECT Data Element: JBOBJNR Data Type: CHAR length (Dec): 22(0) Check table: Conversion Routine: Domain Name: J_OBJNR MemoryID: AppClass: BONR SHLP: SHLP Field: ConvExit: See all SAP tables containing field TREASURYFINANCIALOBJECT
|
ITRSYVARPL-MARKETRISKKEYFIGURESET table field - Market Risk Key Figure Set
▼
Description: Market Risk Key Figure Set Field Name: MARKETRISKKEYFIGURESET Data Element: AFWGO_MRA_KF_SET Data Type: CHAR length (Dec): 6(0) Check table: Conversion Routine: Domain Name: AFWGO_MRA_KF_SET MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field MARKETRISKKEYFIGURESET
|
ITRSYVARPL-VALUEATRISKPROFITANDLOSSVALUE table field - Simulated Profit/Loss for Value-at-Risk Calculation
▼
Description: Simulated Profit/Loss for Value-at-Risk Calculation Field Name: VALUEATRISKPROFITANDLOSSVALUE Data Element: RDBRA_PROFIT_AND_LOSS Data Type: length (Dec): 0(0) Check table: Conversion Routine: Domain Name: MemoryID: AppClass: SHLP: SHLP Field: ConvExit: See all SAP tables containing field VALUEATRISKPROFITANDLOSSVALUE
|
ITRSYVARPL-EVALUATIONCURRENCY table field - Evaluation Currency
▼
Description: Evaluation Currency Field Name: EVALUATIONCURRENCY Data Element: AFW_EVAL_CURRENCY Data Type: CUKY length (Dec): 5(0) Check table: Conversion Routine: Domain Name: WAERS MemoryID: AppClass: FB SHLP: SHLP Field: ConvExit: See all SAP tables containing field EVALUATIONCURRENCY
|
View list of all SAP tables(S4H/ECC)Select data from SAP table